KEGG   Kineococcus radiotolerans: Krad_3227Help
Entry
Krad_3227         CDS       T00562                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00900  Terpenoid backbone biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
Module
kra_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Krad_3227
Enzymes [BR:kra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Krad_3227
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Krad_3227
    2.5.1.29  geranylgeranyl diphosphate synthase
     Krad_3227
Prenyltransferases [BR:kra01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Krad_3227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ABS04691
UniProt: A6WD02
Position
complement(3761221..3762318)
Genome map
AA seq 365 aa AA seqDB search
MQPASPVQPVATSDLRRAVSDVLDEFLRDQASVLREVSEDCAPVLDAISALLSGGKRLRP
AFCYWGFHGTGGELPDEGIVTAAASLELFQAAALIHDDVMDDSDTRRGQPAAHRRFEALH
ARSGWDGSRERFGLAGAVLAGDLCLGWSDELFSRARLAPDALDRGRRIFNVMRTQLMGGQ
YLDMLEQASSDQRGTDGAVDRARRVVTFKSAKYSIEHPLLLGGSLAGASTDLLADYSRFG
LALGEAFQLRDDVLGVFGDPAETGKPAGDDLREGKRTVLIGLAVQAADPTQAAEVRRLLG
SPELDAEGVETLRQVLVDTGALSGVEKIISEQVDVACATLDAADVTEPARAALHELVVAA
TSRRS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccgcctcccccgtccagcccgtggcgaccagcgacctgcgacgtgccgtctcc
gacgtcctcgacgagttcctgcgcgaccaggcctcggtcctgcgggaggtcagcgaggac
tgcgcgccggtcctggacgcgatctccgcgctgctctccggcggcaagaggctgcggccg
gcgttctgctactggggcttccacgggaccggcggggagctgcccgacgaggggatcgtc
accgccgccgcgtcgctggagctgttccaggccgcggcgctcatccacgacgacgtcatg
gacgactccgacacccgccgcggtcagccggcggcgcaccggcgcttcgaggccctgcac
gcgcggtcgggctgggacggcagccgcgagcggttcggcctcgccggcgccgtcctcgcg
ggggacctgtgcctgggctggagcgacgagctgttctcccgcgcccggctggcccccgac
gccctggaccgcggccgccggatcttcaacgtcatgcgcacccagctcatgggcgggcag
tacctggacatgctggagcaggcctcctccgaccagcgcggcaccgacggcgcggtggac
cgggcgcggcgggtggtgaccttcaagagcgcgaagtactccatcgagcacccgctgctg
ctcggggggtcgctggccggggcgtccacggacctgctggccgactactcgcggttcggg
ctcgcgctgggcgaggcgttccagctgcgcgacgacgtgctcggggtgttcggcgacccg
gccgagacgggcaaacccgccggtgacgacctgcgcgagggcaagcgcaccgtgctgatc
gggctcgccgtgcaggcggcggaccccacccaggccgccgaggtacggcggctgctgggt
tccccggagctggacgccgagggtgtcgagacgttgcgccaggtcctggtggacacgggc
gcgttgagtggagtggagaagatcatctctgagcaggtggacgtggcgtgcgccacgctg
gacgcggccgacgtgacggaacccgcgcgagcggccctgcacgagctggtcgtcgcggcg
acgagcaggcgctcgtga

DBGET integrated database retrieval system