KEGG   Kineococcus radiotolerans: Krad_3230Help
Entry
Krad_3230         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 MerR_1 MerR
Motif
Other DBs
NCBI-ProteinID: ABS04694
UniProt: A6WD05
Position
3758231..3758647
Genome map
AA seq 138 aa AA seqDB search
MRRQTGGVVAPLRAEIAREQGTDELDALVPEWLTVPGVAEVTGVDQRVVRRWLQEREIVA
VRRGERSVAQVPAGFVTPEGPLNHLKGTLSVLVDSGYTDTEAIGWLYTPDDSLPGTPIEA
LRANRKTEVRRRAQALGF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcggcagactggtggggtggtcgcaccgttgagagcagagatcgcccgtgagcag
ggcaccgacgagctggacgccctggtccccgagtggctcaccgtccccggcgtggccgag
gtgaccggcgtcgaccagcgcgtcgtgcgccgctggctgcaggagcgcgagatcgtcgcc
gtccgccgcggggagcgttcggtggcgcaggtccccgccgggttcgtcacccccgagggt
ccgctgaaccacctcaagggcaccctgtcggtgctcgtggactccgggtacaccgacacc
gaggccatcgggtggctctacacccccgacgactccctgcccgggacgcccatcgaggcg
ctgcgggccaaccgcaagaccgaggtccggcgccgggcgcaggccctcggcttctga

DBGET integrated database retrieval system