KEGG   Kineococcus radiotolerans: Krad_3248Help
Entry
Krad_3248         CDS       T00562                                 

Definition
(GenBank) putative transcriptional regulator, AsnC family
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg NapD Spore_YhcN_YlaJ GYD
Motif
Other DBs
NCBI-ProteinID: ABS04712
UniProt: A6WD23
Position
complement(3738366..3738644)
Genome map
AA seq 92 aa AA seqDB search
MITAIVNVHCDGRRIPEVAQALAELDGVSEVYSVTGDVDLVVMVRVREHDRLADVIAGGI
ARVEGVVGTTTNIAFRAYSRHDLETAFALGFD
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccgccatcgtcaacgtccactgcgacggccgacgcatccccgaggtcgcgcag
gcgctcgccgagctcgacggcgtcagcgaggtctactcggtgacgggggacgtcgacctc
gtcgtcatggtccgggtccgcgagcacgaccggctggccgacgtcatcgccgggggcatc
gcccgggtcgagggcgtggtcggcacgacgacgaacatcgccttccgcgcctactcccgc
cacgacctcgagacggccttcgccctcgggttcgactga

DBGET integrated database retrieval system