KEGG   Kineococcus radiotolerans: Krad_3249Help
Entry
Krad_3249         CDS       T00562                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
kra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_3249
Enzymes [BR:kra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Krad_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABS04713
UniProt: A6WD24
Position
3737261..3738331
Genome map
AA seq 356 aa AA seqDB search
MTTAPAPTWPGLLTELVAGHDLTAEQASWAMDQVMRGSAGDVQLAGFLVALRAKGETSAE
LTGLAEAMLTHAVPLEVPGPIVDLVGTGGDRAHTVNISTMASLVLAGAGHRVVKHGNRAA
SSSSGSADVLEALGVRLDLPPRRVAQLAVEVGITFCFAQVFHPAMRFAAGARGGLGVPTA
FNVLGPLTNPARPGASAVGVADRRTAPLVAGVLAGRRTSALVFRGEDGLDELTTTGPARV
WVVSGGRVTETVLDAVAELGLPPCTLADLRGADAAHNAGVARELLAGARGPVRDTVVLNA
AAAMVAAGVRAAGSADADPAAGLADHLREGVRRAEAALDSGAAADVLDRWVAASAS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgcccccgcccccacgtggcccggcctgctcaccgagctcgtggccggtcac
gacctcaccgccgagcaggcgtcgtgggcgatggaccaggtgatgcgcggctcggccggc
gacgtccagctcgccgggttcctcgtcgcgctccgcgccaagggcgagaccagcgcggag
ctgaccggcctggccgaggcgatgctgacccacgccgtgccgctggaggtgcccggaccg
atcgtcgacctcgtgggcaccggcggggaccgcgcgcacaccgtgaacatctccacgatg
gcgtcgctggtgctggccggggccggtcaccgcgtcgtcaagcacggcaaccgcgccgcc
tcgtcctcctccgggtccgccgacgtcctcgaggcgctcggggtccggctggacctgccc
ccccggcgggtggcgcagctggccgtcgaggtcgggatcaccttctgcttcgcccaggtc
ttccaccccgcgatgcgcttcgccgccggggcccgcggcgggctcggggtgcccacggcg
ttcaacgtcctggggccgctgaccaaccccgcccgtcccggcgcctcggccgtcggggtc
gccgaccggcgcacggcgccgctggtcgccggcgtcctcgccggccgccgcacctcggcg
ctggtcttccgcggcgaggacggcctcgacgagctcaccacgaccgggcccgcgcgggtc
tgggtcgtcagcgggggacgggtgaccgagacggtcctcgacgccgtcgccgagctgggc
ctgcccccctgcacgctcgccgacctgcgcggggccgacgccgcccacaacgcgggggtc
gcccgcgagctgctcgcgggggcccgcggcccggtgcgcgacaccgtggtgctcaacgcg
gcggcggccatggtggcggccggggtgcgggccgcggggtccgccgacgccgaccccgcc
gcggggctcgcggaccacctgcgcgagggggtgcgccgggccgaggccgccctggactcc
ggcgcggccgccgacgtcctcgaccggtgggtggcggccagcgcctcctga

DBGET integrated database retrieval system