KEGG   Kineococcus radiotolerans: Krad_3251Help
Entry
Krad_3251         CDS       T00562                                 

Definition
(GenBank) cytochrome c class I
  KO
K03889  ubiquinol-cytochrome c reductase cytochrome c subunit
Organism
kra  Kineococcus radiotolerans
Pathway
kra00190  Oxidative phosphorylation
kra01100  Metabolic pathways
Module
kra_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Krad_3251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Cytochrom_C550 Cytochrome-c551 OppC_N CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ABS04715
UniProt: A6WD26
Position
complement(3735391..3736224)
Genome map
AA seq 277 aa AA seqDB search
MTRTLTALSARRRHPLAVVVLIALALLLVGGLYAALAPRDAQASTAAASADDIEAGKKLF
LANCATCHGLDAQGGAVLPDGSGAGPSLIGVGAASVDFQVGTGRMPLAQSAAQAPEVSKI
RFSQEQIDQMAAYIASLAPGPAVPTAEELDVASVSEEDIARGASIFRTNCAMCHNFAGKG
GALTAGKYAPDLTGVSGKHVYEAMVTGPQSMPVFNNNTISPEDKTAIIAWLTQEDVRPDP
GGLSLGSLGPVSEGLLAWIGGIGLLIGVSVWLGMKSS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaggaccctcaccgccctcagcgcccgacggcgccacccgttggccgtcgtcgtg
ctgatcgcgctggcgctcctcctcgtcggcgggctgtacgcggccctggccccgcgcgac
gcgcaggccagcaccgcggcggcctccgccgacgacatcgaggcgggcaagaagctcttc
ctggccaactgcgccacctgccacggcctggacgcccagggcggggcggtgctgcccgac
ggcagcggcgccggcccctcgctcatcggcgtgggcgccgcctcggtcgacttccaggtc
ggcaccgggcggatgccgctggcccagtcggccgcgcaggcccccgaggtcagcaagatc
cgcttctcgcaggagcagatcgaccagatggccgcctacatcgcctccctggcgccgggg
ccggccgtccccaccgcggaggagctcgacgtcgccagcgtgagcgaggaggacatcgcc
cgcggcgcgtccatcttccgcacgaactgcgcgatgtgccacaacttcgccggcaagggc
ggcgcgctgacggcgggcaagtacgcccccgacctcaccggcgtctccggcaagcacgtc
tacgaggccatggtcaccggcccgcagtcgatgccggtcttcaacaacaacacgatcagc
cccgaggacaagacggcgatcatcgcctggctgacccaggaggacgtgcggccggacccg
ggcgggctcagcctgggctccctcgggccggtctccgagggtctgctggcctggatcggc
ggcatcggcctgctgatcggcgtgtcggtgtggctggggatgaagtcctcctga

DBGET integrated database retrieval system