KEGG   Kineococcus radiotolerans: Krad_3254Help
Entry
Krad_3254         CDS       T00562                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NmrA GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ABS04718
UniProt: A6WD29
Position
complement(3731767..3732543)
Genome map
AA seq 258 aa AA seqDB search
MTPPPTPGPLAPGSLSGTRALVTGSSRGIGAQTVTYLAQAGASVVVNYRNKAARAEKLVA
QLAEAGTTAIAVGADLTDDASVAAMFERARAELGGLDLLVLNASGGMEQGMAADYAMQLN
RDAQVRVLRTALPLMAPGSRVVFVTSHQAHFIETVETMPEYEAVARSKRAGEDALRALLP
ELDAAGVEFVVVSGDMIEGTITATLLERSNPGALATRKEAAGKLYDVAGFAAEVALAAVE
PVPADRTRYVGDISSFTG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctccccccacccccggtcccctcgccccggggagcctctccggcacccgcgcc
ctcgtcaccggctcctcccgcggcatcggggcccagaccgtgacgtacctggcgcaggcg
ggtgcgtccgtggtcgtcaactaccgcaacaaggcggctcgcgccgagaagctggtggcc
cagctcgccgaggcgggcacgaccgccatcgccgtcggcgcggacctcaccgatgacgcc
tccgtcgcggcgatgttcgagcgcgcccgcgccgagctcggcggcctggacctgctggtg
ctcaacgcctccggcggcatggagcagggcatggccgcggactacgccatgcagctcaac
cgcgacgcccaggtgcgcgtcctgcggacggcgctgcccctcatggcgcccgggtcccgc
gtcgtcttcgtcaccagccaccaggcgcacttcatcgagaccgtcgagacgatgccggag
tacgaggccgtcgcgcgcagcaagcgggccggcgaggacgcgctgcgggcgctgctcccc
gagctggacgcggcgggcgtcgagttcgtcgtcgtgtccggcgacatgatcgagggcacc
atcaccgccaccctgctcgagcgttccaacccgggcgcgctggcgacccgcaaggaagcg
gccggcaagctgtacgacgtggccggtttcgccgccgaggtggccctggccgccgtggaa
ccggtccccgccgaccgcacccgctacgtcggggacatctccagcttcaccggctga

DBGET integrated database retrieval system