KEGG   Kineococcus radiotolerans: Krad_3266Help
Entry
Krad_3266         CDS       T00562                                 

Definition
(GenBank) conserved hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS04730
UniProt: A6WD41
Position
3720352..3720561
Genome map
AA seq 69 aa AA seqDB search
MRPTQWTWKYEDADGRALAGDNAVFPTQSDAETWIGEAWRGLRERGVENAHLWADGARVY
GPLSLRPAD
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccgacgcagtggacctggaagtacgaggacgccgacgggcgcgccctcgccggc
gacaacgccgtgttccccacgcagtccgacgccgagacgtggatcggcgaggcctggcgg
gggctgcgcgagcgcggcgtggagaacgcccacctgtgggccgacggcgcccgggtctac
ggcccgctgtcgctgcgccccgcggactga

DBGET integrated database retrieval system