KEGG   Kineococcus radiotolerans: Krad_3282Help
Entry
Krad_3282         CDS       T00562                                 

Definition
(GenBank) amine oxidase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 Thi4 HI0933_like FAD_oxidored FAD_binding_3 Lycopene_cycl Pyr_redox_3 GIDA AlaDh_PNT_C Pyr_redox NAD_binding_9 Shikimate_DH 3HCDH_N TrkA_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABS04746
UniProt: A6WD57
Position
complement(3700003..3701358)
Genome map
AA seq 451 aa AA seqDB search
MTVSTTPDATSPAPHGTESPYASSLRSSAEVVVVGAGLAGLACAKHLSAAGLDVLVVEAA
EAVGGRVRSETVGGFRVDRGFQLLNPGYPEVLKVLDLDALDLQPFDAGVAVHRGGRVSVV
RDPRRHPTAVLEALRFPLGTVKEKAALARWIVKVTSAGELKGPDSGWSQGLDAAEVHGEL
RWSVLEPFLAGVLGEVDGTTSRRFVDLLVRSFLRATPALPARGVQAVPDQLAAGLPAGSV
VLGTKVRHIGFAPRSLVVETVAGGVNCQRIVVATDAHTAAHLVPELRVPDSHGLSTFWFA
APTSPAPESRERLLHLDGDRSGPVVNSAVVSAVAPGYVVDGTDRRALVSAQTLGTDTGAE
AERRVREQLGRVYGVGTAGWELVAAHEVPHALPVVAPPFEGPQPVDAGDGVFVAGDHREN
SSQQGALVSGRRAADAVLSDVFGRSGSRRAG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcagcaccacacccgatgccacctcgcccgccccgcacgggacggagtccccg
tacgcctcgtcgttgcgctcctcggccgaggtggtcgtcgtcggggcggggttggcgggt
ctggcctgcgccaagcacctgagcgccgccgggctcgacgtgctcgtcgtggaggccgcc
gaggccgtcggggggcgggtgcgctcggagacggtcgggggcttccgggtcgaccgcggg
ttccagctgctgaacccgggctacccggaggtgctcaaggtcctcgacctcgacgcgctg
gacctgcagccgttcgacgcgggtgtcgccgtgcaccgcggtggccgggtgagcgtggtg
cgcgacccgcgccgccaccccaccgccgtcctggaggcgctgcgcttcccgctgggcacg
gtgaaggagaaggcggcgctggcgcgctggatcgtcaaggtgacctcggcgggcgagctg
aagggcccggactccggctggtcgcaggggctggacgccgcggaggtccacggcgagctg
cgctggtcggtcctggagcccttcctggccggggtgctcggcgaggtcgacggcaccacg
tcgcgccgcttcgtcgacctgctggtgcgcagcttcctgcgggcgaccccggcgctgccc
gcccgcggcgtgcaggccgtccccgaccagctcgcggcggggctgcccgcggggtcggtg
gtcctgggcacgaaggtgcgccacatcggcttcgcgccgcgctcgctggtcgtggagacc
gtcgccgggggcgtgaactgccagcggatcgtcgtggcgaccgacgcgcacaccgccgcc
cacctggtgccggagctccgggtccccgacagccacgggttgtccacgttctggttcgcc
gcgccgacctcccccgccccggagtcccgcgagcgcctgctgcacctggacggggaccgc
tcgggacccgtcgtgaactccgccgtcgtctccgccgtcgcccccggctacgtcgtggac
ggcaccgaccgccgggccctggtcagcgcgcagaccctcggcaccgacaccggcgccgaa
gccgagcgccgggtgcgcgagcagctgggacgggtgtacggggtgggcaccgcggggtgg
gaactggtggccgcccacgaggtcccgcacgcgctccccgtcgtggcgccgcccttcgag
ggcccgcagccggtcgacgccggcgacggcgtgttcgtcgccggcgaccaccgggagaac
tcctcgcagcagggggcgctggtctccggccgccgcgccgccgacgcggtgctgtccgac
gtcttcggccgcagcggttcgcgccgtgccggctga

DBGET integrated database retrieval system