KEGG   Kineococcus radiotolerans: Krad_3284Help
Entry
Krad_3284         CDS       T00562                                 

Definition
(GenBank) lipoate-protein ligase B
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00785  Lipoic acid metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Krad_3284
Enzymes [BR:kra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     Krad_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB DUF2630
Motif
Other DBs
NCBI-ProteinID: ABS04748
UniProt: A6WD59
Position
complement(3698517..3699161)
Genome map
AA seq 214 aa AA seqDB search
MVERVRLGGEPVDYREAWDLQRRRHAEVVAGERPDTVLLLEHPPVYTAGRRTNSWERPDD
GTPVVDVDRGGRITWHGPGQLVGYPIVRLHGALDVVGYVRRLEELLIGVCAAFGVEGYRV
EDRTGVWTRDEPLREGWRAEGKLAAIGVRVAKGVTMHGFALNCDTDLQGFSRIVPCGLPD
AGASSLSARAGRRVGVLDAAAVVEALLPGAALPG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgagcgggtgcggctcggcggggaacccgtcgactaccgcgaggcctgggacctg
cagcgccgccggcacgccgaggtcgtcgccggcgagcgccccgacaccgtgctgctgctg
gagcacccccccgtctacacggcggggaggcggacgaactcctgggaacgccccgacgac
gggacccccgtcgtcgacgtcgaccgcggtggccggatcacctggcacgggccgggtcag
ctggtggggtacccgatcgtccggttgcacggggcgctcgacgtcgtggggtacgtgcgc
cggctggaggagctgctcatcggcgtctgcgccgccttcggcgtcgagggctaccgcgtc
gaggaccgcaccggggtctggacccgcgacgagcccctgcgggaggggtggcgcgcggag
ggcaagctcgccgcgatcggggtgcgcgtcgcgaagggggtcaccatgcacggcttcgcg
ctgaactgcgacaccgacctgcaggggttcagccgcatcgtgccctgcggcctgcccgac
gccggggcgtcgtcgctgagcgcgcgcgccgggcgccgcgtcggggtcctcgacgcggcc
gccgtcgtcgaggccctcctcccgggggcggccctgcccgggtga

DBGET integrated database retrieval system