KEGG   Kineococcus radiotolerans: Krad_3287Help
Entry
Krad_3287         CDS       T00562                                 

Definition
(GenBank) beta-lactamase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABS04751
UniProt: A6WD62
Position
complement(3695074..3696465)
Genome map
AA seq 463 aa AA seqDB search
MDVALLPGTTRTLDHLLAREQSEARLPSVVAGLVRGGRLVWSGGRGTTGVDGEPGAGPDP
LDTQYRVGSISKTFVAAAVLRAVEDGLVGLEDPVRAHLPELVDGVGRVTVGQLLGQAGGV
QAETDGPWWERTEGGDWDSLRPILGESAVRHRPGTRFHYSNVGFGVLGELVGRVRDSTWR
EVVAAQFLVPLGMTRTTPRPQAPAARGLAVHPWADVVLPEPEHDAGAMAPAGQLWSTVAD
LARWAGVVAGTSGVLRRSTVEAMWEPQSVDDARGSAWSVGYGLGLQVWNAGGRRHAGHSG
SMPGFVAMLRVDVETGDGVVVMTNSTSGFGDLPARLLTTLAEREPLDPEPWAPREVPADV
LELVGPWYWGPSPLVVRAGRDGGFDLRGLTGRGRASRFVPAGEPGLWRGLDGYYAGELLR
PVRGADGGVSHLDLASFRLTRTPYDPDADVPGGVDAGGWTGGA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgcgctgctccccggcaccacccgcaccctggaccacctcctcgcccgcgag
cagtccgaggcccggctgccgtcggtggtggccggtctggtgcgcgggggccggctggtg
tggagcggcggtcgcggcacgaccggggtcgacggggagcccggcgccgggccggacccg
ctggacacccagtaccgggtgggttccatctccaagaccttcgtcgccgcggcggtcctg
cgggccgtcgaggacggcctcgtggggctggaggaccccgtgcgggcgcacctgcccgag
ctcgtcgacggggtggggcgggtcaccgtcgggcagctgctcgggcaggccggcggggtc
caggccgagaccgacggcccctggtgggagcgcaccgagggcggggactgggactccctg
cgcccgatcctcggggagagcgcggtgcggcaccggcccgggacccgcttccactactcc
aacgtcggcttcggcgtcctgggcgagctcgtcgggcgggtccgcgacagcacctggcgc
gaggtcgtcgccgcccagttcctggtgccgctcggcatgacgcgcaccacgccgcgcccg
caggcccccgccgcgcgcggcctggccgtgcacccctgggccgacgtcgtcctgcccgaa
cccgagcacgacgccggggcgatggcccccgccgggcagctgtggtccaccgtcgccgac
ctggcccgctgggcgggcgtcgtggcggggacctccggcgtgctgcggcgcagcaccgtc
gaggccatgtgggaaccccagagcgtcgacgacgcccggggctcggcgtggagcgtgggc
tacggcctggggttgcaggtgtggaacgcgggcggtcgccgccacgcggggcactccggt
tccatgcccgggttcgtcgcgatgctgcgcgtggacgtcgagaccggggacggggtcgtc
gtgatgacgaactcgacctcggggttcggggacctgccggcccggctgctgacgacgctg
gccgagcgggaaccgctggaccccgagccgtgggcgccgcgggaggtccccgccgacgtc
ctcgagctggtcggcccctggtactggggcccgtcccccctggtggtccgggccgggcgc
gacggcggcttcgacctgcggggcctgaccgggcgcgggcgggcgtcccggttcgtgccc
gccggagagccggggctgtggcgcgggctggacggctactacgccggggagctgctgcgg
cccgtccgcggcgccgacggcggcgtgagccacctcgacctcgccagcttccgcctgacc
cgcaccccctacgaccccgacgccgacgtgcccggcggggtcgacgccggggggtggacg
ggcggggcctga

DBGET integrated database retrieval system