KEGG   Kineococcus radiotolerans: Krad_3288Help
Entry
Krad_3288         CDS       T00562                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00785  Lipoic acid metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Krad_3288
Enzymes [BR:kra01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Krad_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: ABS04752
UniProt: A6WD63
Position
complement(3694038..3695039)
Genome map
AA seq 333 aa AA seqDB search
MTIAPEGRRMLRIEARNAETPIERKPSWIRTKARTGPDYTELKGLVKSGGLHTVCEEAGC
PNIYECWEDREATFLIGGSECTRRCDFCQIDTGKPSPLDRDEPRRVAESIATMGLRYATI
TGVARDDLDDGGAWLYAETIRATHAANPGTGVEILVPDFNGKPELLQQVFDAQPEVFAHN
VETVPRIFKSIRPAFRYERSLDVITQGRDAGLVTKSNLILGMGETDEEVLEALADLRGAG
CDIITITQYLRPTPRHHPVERWVKPEKFVEFSAEAERLGFAGVMAGPLVRSSYRAGRLWA
QAMKRRGVAIPAQLAHLDKESPAAQEASSLLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgcaccggaaggccggcggatgctgcgcatcgaggcgcgcaacgccgagacg
ccgatcgagcggaagccgtcgtggatccgcacgaaggcccgcaccggccccgactacacc
gagctcaaggggctggtgaagtccggcggcctgcacacggtgtgcgaggaggccggctgc
cccaacatctacgagtgctgggaggaccgcgaggccacgttcctcatcggcggctccgag
tgcacccgccgctgcgacttctgccagatcgacacgggcaagccctccccgctggaccgc
gacgagccgcggcgggtggcggagagcatcgccacgatgggcctgcgctacgccacgatc
accggtgtcgcccgcgacgacctcgacgacggcggggcgtggctgtacgccgagacgatc
cgcgccacccacgccgccaaccccggcaccggcgtcgagatcctcgtgcccgacttcaac
ggcaagccggagctgctgcagcaggtcttcgacgcccagccggaggtgttcgcccacaac
gtcgagacggtgccgcggatcttcaagagcatccgccccgccttccgctacgagcgctcc
ctcgacgtcatcacccagggccgcgacgcgggcctggtgacgaagtccaacctcatcctc
gggatgggcgagaccgacgaggaggtcctcgaggcgctcgccgacctgcgcggggccggg
tgcgacatcatcaccatcacccagtacctgcgtcccaccccgcgccaccaccccgtggag
cgctgggtgaagccggagaagttcgtggagttctccgccgaggccgagcgcctgggcttc
gccggggtcatggccggcccgctggtgcgttcctcctaccgcgccgggcggctgtgggcg
caggcgatgaagcggcgcggggtggcgatcccggcgcagctggcccacctcgacaaggag
agccccgccgcgcaggaggcgtccagcctgctcgcccgctga

DBGET integrated database retrieval system