KEGG   Kineococcus radiotolerans: Krad_3289Help
Entry
Krad_3289         CDS       T00562                                 

Definition
(GenBank) integral membrane protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4191 ATPase_gene1 RDM DUF4131
Motif
Other DBs
NCBI-ProteinID: ABS04753
UniProt: A6WD64
Position
complement(3693261..3693992)
Genome map
AA seq 243 aa AA seqDB search
MARREKPAGATPAQKPKKKRFARTRQLKQVYDMTVRVDPGAKWWLLLAFAGPVVLGLLIG
LLVDHPIYFTILGLLVGVLAGMFVLGRRAERAAYVNLKGQKGAAGAALSSIRRGWTIEQE
PVAAEARTQDMVFRATGRGGIVLVGDGPPTRVKKLLEAERRKVSRIVPNVPVHLFTVGDG
DTEGEVPLHKLASRVQRLKPQLTKQEVAAVQKRLRALGGIRPPVPKGIDPMRARPDRKAM
RGR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacgtgagaagcctgcgggcgcgaccccggcgcagaagccgaagaagaagcgg
ttcgcgcgcacgcgccagttgaagcaggtctacgacatgaccgtccgggtcgacccgggc
gcgaagtggtggctgctgctggccttcgcgggcccggtcgtcctcggtctgctcatcggt
ctcctggtcgaccacccgatctacttcacgatcctcggcctcctggtcggggtgctcgcc
ggcatgttcgtcctcggccggcgcgccgagcgcgccgcgtacgtgaacctcaagggccag
aagggcgcggccggcgcggccctcagctccatccggcgcgggtggacgatcgagcaggag
ccggtcgccgcggaggcccgcacccaggacatggtcttccgcgccaccggccgcggcggg
atcgtcctggtgggcgacggcccgcccacccgggtgaagaagctgctcgaggccgagcgg
cgcaaggtctcccgcatcgtccccaacgtgcccgtgcacctgttcaccgtcggcgacggc
gacaccgagggcgaggtgccgctgcacaagctcgcctcccgcgtccagcgcctcaagccc
cagctgaccaagcaggaggtcgccgccgtgcagaagcggctgcgcgcgctcggcgggatc
cgtcctccggtgcccaagggcatcgacccgatgcgcgcccgtcccgaccgcaaggccatg
cgcggacgctga

DBGET integrated database retrieval system