KEGG   Kineococcus radiotolerans: Krad_3498Help
Entry
Krad_3498         CDS       T00562                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00970  Aminoacyl-tRNA biosynthesis
Module
kra_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:kra00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Krad_3498
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kra01007]
    Krad_3498
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kra03016]
    Krad_3498
Enzymes [BR:kra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Krad_3498
Amino acid related enzymes [BR:kra01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Krad_3498
Transfer RNA biogenesis [BR:kra03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Krad_3498
 Prokaryotic Type
   Other AARSs
    Krad_3498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABS04961
UniProt: A6WDS2
Position
3460339..3463596
Genome map
AA seq 1085 aa AA seqDB search
MSQDANPDVTTPDVPVGTADDTAADATSSPRFPEIEQRVLDSWAADGTFPASVEARRGSA
AGEFVFYDGPPFANGLPHYGHLLTGYVKDLVPRYKTMRGHRVERRFGWDTHGLPAEVEAE
KQLGITHKSQIDELGIATFNETCRTSVLRYTAEWERYVTRQARWVDFDNDYKTLDTDYME
SVMWAFKTLWDKGLIYEGFRVLAYCWRCETPLSNSETRLDDVYRNRQDPAVTVGFRLLGE
GADDALDGVLALIWTTTPWTLPSNLAMAVHPDLDYVVVTGTGAHEGRRFLLAAERLAHYA
RELGEDAAERVVARYRGADLLRRRYVPPFDYFAGRENAHQVLAADYVTTDSGTGIVHIAP
AFGEDDKLVTDAAGIVPVVPVASNGTFTAEVRDFAGMHVFDANKEINRALRDGVPSGALL
LRLETYDHSYPHCWRCGNALIYRAVSSWFVKVTAIRDRMVELNEQITWVPEHVKHGSFGK
WLEGARDWSISRSRYWGSPVPVWTSDDPAYPRVDVYGSLDDLERDFGVRPADLHRPTIDD
LTRPNPDDPTGRSTMRRVPEVLDCWFESGSMPFAQVHYPFENSEWFESHYPGDFIVEYIG
QTRGWFYTLHVLATALFDRPAFRTAVSHGILLGDDGRKMSKSLRNYPDVSEVLDRDGSDA
MRWFLMSSPVLRGGNLIVTEQGIRDSVRQVLLPLWNTFSFLRLYSGTSSHTPRWRTTSPD
VLDRYVLAKLHDTVVTVTEQLDAYDIAGACETVRQFLDSLTNWYVRRSRAAFWDGESERA
RDAFDTLHTVLETTTRLLAPMLPLVSEEIWRALTGGRSVHLTDWPDPLDLPSDPALVAAM
DEARVTCSNALALRKANGLRVRLPLNRLEVLVADPAALQPFAQLVADEVNVREVALGPIE
RAAEYGVVAKLTVNARAAGPRLGKQVQQAIRASKSGDWEERPDGTVVAGGIELAEGEYEL
TTVVEGADTGRATAPLEGGGFVVLDTTVTPELAAEGIARDVVRLVQQARRDAGLHVSDRI
RLTIAADGPVWEALVTHQNLVVDETLAQQFGSTGSAAALPVEKATLVGSVEGHEVRVVVQ
KAEQL
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccaggacgcgaacccggacgtgaccacccctgacgtccccgtcggcaccgcggac
gacaccgcggcggacgccacgagcagcccccgcttccccgagatcgagcagcgcgtcctg
gactcctgggccgccgacggcacgttcccggccagcgtcgaggcccgccggggctccgcg
gccggggagttcgtcttctacgacggcccgcccttcgccaacggcctgccccactacggc
cacctgctcaccgggtacgtcaaggacctcgtcccgcgctacaagacgatgcgcgggcac
cgggtcgagcgccgcttcggctgggacacccacggcctgcccgccgaggtcgaggccgag
aagcagctcggcatcacccacaagtcccagatcgacgagctcggcatcgccacgttcaac
gagacctgccgcacctcggtgctgcgctacaccgcggagtgggagcgctacgtcacccgc
caggcgcggtgggtggacttcgacaacgactacaagaccctcgacaccgactacatggag
tcggtcatgtgggcgttcaagacgttgtgggacaaggggttgatctacgaggggttccgc
gtcctggcctactgctggcgctgcgagaccccgctgagcaactccgagacccgcctggac
gacgtctaccgcaaccgccaggaccccgccgtcaccgtcgggttccgcctgctgggcgag
ggcgcggacgacgccctcgacggggtgctcgccctcatctggaccaccacgccctggacg
ctgcccagcaacctcgcgatggccgtccaccccgacctcgactacgtcgtcgtcacgggc
accggcgcgcacgagggccgccgcttcctgctggccgccgagcgcctggcccactacgcc
cgcgagctcggcgaggacgccgccgagcgcgtcgtcgcccgctaccgcggcgccgacctc
ctcaggcgccgctacgtcccgcccttcgactacttcgccggccgcgagaacgcccaccag
gtcctcgccgccgactacgtgaccaccgactccggcaccgggatcgtgcacatcgccccc
gccttcggcgaggacgacaagctcgtcaccgacgccgccggcatcgtccccgtcgtcccc
gtcgcctccaacggcacgttcaccgccgaggtgcgcgacttcgccgggatgcacgtcttc
gacgccaacaaggagatcaaccgcgccctgcgcgacggcgtcccctccggggcgctgctg
ctgcggctggagacctacgaccactcctacccgcactgctggcgctgcgggaacgccctg
atctaccgggccgtgtccagctggttcgtcaaggtcaccgccatccgcgaccggatggtc
gagctcaacgagcagatcacctgggtccccgagcacgtcaagcacggctccttcggcaag
tggctcgaaggcgcccgggactggtccatcagccggagccgctactggggcagccccgtc
ccggtgtggacgtcggacgaccccgcctacccgcgcgtcgacgtgtacgggtcgctggac
gacctcgagcgcgacttcggcgtgcgcccggccgacctgcaccgccccaccatcgacgac
ctcacccggcccaaccccgacgaccccacgggccgctcgaccatgcgccgggtcccggag
gtcctcgactgctggttcgagtccgggtccatgcccttcgcccaggtgcactacccgttc
gagaactccgagtggttcgagagccactacccgggcgacttcatcgtcgagtacatcggg
cagacccgcggctggttctacaccctgcacgtcctggccaccgccctcttcgaccgcccc
gcgttccggaccgccgtctcgcacggcatcctgctcggcgacgacggccggaagatgagc
aagtcgctgcgcaactaccccgacgtgtccgaggtcctggaccgcgacgggtccgacgcc
atgcgctggttcctcatgagctcccccgtgctgcgcgggggcaacctcatcgtcaccgag
cagggcatccgcgactccgtccgccaggtcctgctgccgctgtggaacacgttctcgttc
ctccggctgtactcggggacctccagccacaccccgcgctggcggacgacctcgcccgac
gtcctcgaccgctacgtcctggccaagctgcacgacaccgtcgtgacggtgaccgagcag
ctcgacgcctacgacatcgccggggcctgcgagaccgtccggcagttcctggactccctc
accaactggtacgtccggcgctcgcgcgcggcgttctgggacggggagtccgagcgcgcc
cgcgacgcgttcgacaccctgcacaccgtgctggagaccacgacgcggctgctcgcgccg
atgctgccgctggtgtccgaggagatctggcgcgccctcaccggcggccgctcggtgcac
ctgaccgactggccggacccgctggacctgcccagcgacccggccctggtcgcggccatg
gacgaggcccgggtgacctgctccaacgcgctggcgctgcgcaaggccaacgggctgcgg
gtgcgcctgccgctgaaccggctggaggtcctcgtcgccgaccccgcggcgctgcagccg
ttcgcgcagctcgtcgcggacgaggtcaacgtccgcgaggtcgcgctggggccgatcgag
cgcgccgccgagtacggcgtcgtcgccaagctcaccgtgaacgcccgcgccgccggcccg
cgcctgggcaagcaggtgcagcaggccatccgggcctccaagtcgggggactgggaggaa
cgccccgacggcacggtcgtcgccgggggcatcgagctcgccgagggcgagtacgagctg
accaccgtcgtcgagggcgcggacaccgggcgggccaccgcaccgctggagggcggcggt
ttcgtcgtcctcgacaccaccgtgaccccggagctggcggccgaggggatcgcccgcgac
gtcgtccgcctcgtccagcaggcccgccgcgacgccggcctgcacgtgtcggaccggatc
cggctgacgatcgccgccgacgggccggtgtgggaggcgctggtgacccaccagaacctc
gtcgtcgacgagacgctggcgcagcagttcggctccaccgggtcggccgcggcgctgccg
gtggagaaggcgacgctggtgggcagcgtcgagggtcacgaggtgcgcgtcgtggtgcag
aaggcggagcagctgtga

DBGET integrated database retrieval system