KEGG   Kineococcus radiotolerans: Krad_4193Help
Entry
Krad_4193         CDS       T00562                                 

Definition
(GenBank) Mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00051  Fructose and mannose metabolism
kra01100  Metabolic pathways
kra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Krad_4193
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     Krad_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N Cas_Csa4 MAAL_C
Motif
Other DBs
NCBI-ProteinID: ABS05656
UniProt: A6WFR7
Position
complement(2687913..2689274)
Genome map
AA seq 453 aa AA seqDB search
MAGPERFTRFETLDVRFPTSRHLDGSDAMNPDPDYSAAYLVLGTDDPRSPEGHGFAFTIG
RGNDVQVAAIKALAGHVLGRDVEEVLGDMGATWRSFADDSQLRWLGPEKGVMHMAVSAVV
NALWDLKAKRAGLPLWDLLSRMSPEELVALVDFRYLTDALTPEDALELLRAAVPGRARRR
AELLREGYPAYTTTPGWLGYSDEKLVRLAREAVAQGFRQIKLKVGADVDDDVRRMRLARA
AVGPDVRIAVDANQRWDVGPAVEWIRALAPHDPWWVEEPTSPDDVLGHAAIRRAVAPVKI
ATGEHAHNRVVFKQLLQAGSLDVVQIDAARVAGVNENVAILLLAAKFGVPVCPHAGGVGL
CELVQHLSMFDFVALTGTTEDRVVEHVDHLHEHFVDPVRLSRGNYLAPTAPGYSAEIRRE
SLLRHVFPGGAEWAGVPVAVPSPAGPHAEEVAR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcggggccggagaggttcacccggttcgagaccctcgacgtgcgcttccccacctcc
cgccacctcgacggttccgacgccatgaaccccgacccggactactccgccgcctacctc
gtcctgggcaccgacgacccgcgatcaccggaggggcacggtttcgccttcaccatcggc
cgcggcaacgacgtgcaggtcgccgcgatcaaggccctcgccggccacgtcctgggccgc
gacgtcgaggaggtcctgggcgacatgggcgccacctggcggtccttcgccgacgactcg
cagctgcggtggctgggcccggagaagggcgtcatgcacatggccgtctccgccgtcgtc
aacgcgctgtgggacctcaaggccaagcgcgcggggttgccgctgtgggacctgctctcg
cggatgtccccggaggaactcgtcgcgctggtggacttccgctacctcaccgacgccctc
acccccgaggacgcgctggaactgctgcgggccgccgtccccggccgggcccggcggcgg
gcggaactgctgcgcgagggctaccccgcgtacaccacgaccccgggctggctgggctac
tccgacgagaagctcgtgcggctggcccgcgaggccgtcgcccaggggttccgccagatc
aagctcaaggtcggcgccgacgtcgacgacgacgtgcgccggatgcggctggcccgggcg
gcggtggggccggacgtgcgcatcgccgtcgacgccaaccagcgctgggacgtcggcccc
gcggtggagtggatccgcgccctcgccccccacgacccgtggtgggtggaggaaccgacg
agcccggacgacgtcctgggccacgccgcgatccgccgcgcggtggcgccggtgaagatc
gccaccggtgagcacgcgcacaaccgcgtggtgttcaagcagctgctgcaggcgggttcc
ctggacgtcgtgcagatcgacgcggcccgcgtcgcgggcgtcaacgagaacgtcgcgatc
ctgctgctggccgcgaagttcggggtcccggtgtgcccgcacgcgggcggggtggggttg
tgcgaactggtgcagcacctgtcgatgttcgacttcgtcgccctcaccgggaccaccgag
gaccgggtcgtcgagcacgtcgaccacctccacgagcacttcgtggacccggtgcggctc
tcgcgggggaactacctcgcccccaccgcacccgggtactccgccgagatccgccgggag
tcgctgctgcgccacgtcttccccggcggggcggagtgggcgggggtcccggtcgcggtc
ccctccccggccgggccgcacgccgaggaggtggcgcggtga

DBGET integrated database retrieval system