KEGG   Kosakonia radicincitans: A3780_08385Help
Entry
A3780_08385       CDS       T04579                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
krd  Kosakonia radicincitans
Pathway
krd00010  Glycolysis / Gluconeogenesis
krd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3780_08385
Enzymes [BR:krd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A3780_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: APG20985
Position
1838160..1839359
Genome map
AA seq 399 aa AA seqDB search
MSAPVALAQEIPQGYQLQQVLIMSRHNLRAPLANNGSVLEQSTPNRWPQWDVPGGELTTK
GGVLEVYMGHFMREWLVKEQLLKAGECPSANSVYVWANSLQRTVATAQFFTNGAFPGCDV
PVHHQEKMGTMDPTFNPVITEDSAKFSQQAVNAMEAQRQKFALNESYQLLEKITHYRASP
ACKEKQQCSLTDAKDTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYYEGFPLDQVAWGEIK
SDAQWRLLSKLKNSYQDTLFTSPEVARNVAKPLVKYLDKTLVEEASSAPKITVLVGHDSN
IASLLTALNFEPYQLHNQYERTPIGGKIVFQRWHDTAGKRDVMKIEYVYQSTEQLRNTEP
LSLASPAQRVTLALKGCPVDSNGFCPVDKFNALMRDAAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccgtcgcgctggcgcaggagatacctcaagggtatcaattacaacaggtt
ttgatcatgagccgccacaacctgcgtgcgccgttagccaataacggcagcgtactggaa
caatcgacgccgaaccgctggccgcaatgggacgtaccaggcggtgagttgaccaccaaa
ggcggcgtactggaagtgtacatgggccattttatgcgtgaatggctggtcaaagagcag
ttgttgaaagcgggagagtgtccatccgcgaacagtgtctacgtctgggctaacagtctg
caacgcacggttgccaccgcgcaattcttcaccaacggcgcatttcctggctgtgatgtt
ccggttcatcatcaggaaaaaatgggcaccatggatcccacttttaatccggtgatcacc
gaagattcggctaaattcagccagcaggcggtcaacgcaatggaggcgcagcgccagaag
tttgcgctgaatgagagttaccagttgctggaaaaaatcacgcactatcgcgcgtctccg
gcctgtaaagagaaacagcagtgctcactcaccgatgcaaaagatacctttagcgcaaaa
tatcagcaggagccgggcgtgtccgggccgctgaaagtcggcaattcgctggtggatgcc
tttacgttgcaatattacgaaggtttcccgcttgatcaggttgcgtggggagagattaaa
agcgacgcgcaatggcgcctattgtcgaagctgaaaaacagttatcaggacacgctgttc
acctcgccggaagtggcgcgcaatgtagcgaaacccctggtgaaatacctcgacaaaacg
ctggtggaagaggcaagtagcgcgccgaaaatcaccgttctggtcgggcatgactccaac
attgcctccctgctgaccgcgctcaatttcgagccttaccagttgcataaccagtacgag
cgtacgcccatcggcgggaaaattgtgttccagcgctggcacgacacggcgggtaaacgc
gatgtcatgaaaattgaatacgtttatcagagtacggaacaactgcgaaacaccgagccg
ctatcgctggcttccccggctcagcgcgtcaccctggcgctaaaaggctgcccggtagac
agcaatggtttctgcccggtagataaatttaatgcgctgatgcgtgatgcagcgaaataa

DBGET integrated database retrieval system