KEGG   Kosakonia radicincitans: A3780_12250Help
Entry
A3780_12250       CDS       T04579                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
krd  Kosakonia radicincitans
Brite
KEGG Orthology (KO) [BR:krd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3780_12250
Enzymes [BR:krd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     A3780_12250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: APG18291
Position
complement(2683962..2684822)
Genome map
AA seq 286 aa AA seqDB search
MSDTNYAIIYDLHSHTSASDGLLSPEQLVHRAVEMRVGTLAITDHDTTAAIPAARAEIVR
AGLALELISGVEISTVWENHEIHIVGLNIDIENPAMCEFLQQQSARRIQRAQLIAGRLEK
AHIPGAWEGAQRLAQGASVTRGHFARFLVEQGKASNIADVFKKYLARGKTGYVPPQWCTI
EQAIEVIHHSGGTAVLAHPGRYNLSAKWLKRLLAHFADRGGEAMEVAQCQQAPNERAQLA
GYARQYGLLASQGSDFHQPCPWIELGRKLWLPAGVEGVWLKWEQPQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacacgaactacgccataatttatgacctgcatagccacaccagcgcctctgac
ggcttgctttctccggaacaactggtacatcgcgcggtagaaatgcgcgtgggcacgctg
gccattaccgatcacgataccacagccgcgatccctgcggcacgggctgaaattgtccgt
gccgggctggcgctggaattaattagtggcgtggaaatctccaccgtctgggaaaatcat
gaaatccatatcgtgggtctgaacattgatatcgaaaacccggcgatgtgcgaatttttg
cagcagcagtccgcgcgtcgtattcagcgcgcgcaactgattgccgggcgtctggaaaaa
gcgcatattcccggcgcgtgggaaggcgcacagcgactggcgcagggcgcgagcgtgacg
cgtggtcactttgcacgctttctggtggagcagggtaaggccagtaacatcgccgatgtt
tttaaaaaatatcttgcgcgcgggaaaacgggatatgttccgccgcagtggtgtacaata
gaacaagctattgaagtgattcatcattctggcggaacggcggtgctggcccatcctggt
cgttataacctttccgctaaatggctgaaaagactgctggcgcattttgctgaccgcggc
ggggaggcgatggaagttgcccaatgccagcaggctcccaatgaacgagcgcagctcgcc
gggtatgcccgccagtatggtttgctggcgtcgcaaggatcggatttccatcagccctgc
ccgtggattgaactggggcgaaaactctggctaccggccggtgttgaaggcgtctggctg
aaatgggagcagccgcagtaa

DBGET integrated database retrieval system