KEGG   Kosakonia radicincitans: A3780_12940Help
Entry
A3780_12940       CDS       T04579                                 

Definition
(GenBank) hypothetical protein
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
krd  Kosakonia radicincitans
Pathway
krd00270  Cysteine and methionine metabolism
krd00920  Sulfur metabolism
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A3780_12940
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A3780_12940
Enzymes [BR:krd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A3780_12940
    2.3.1.46  homoserine O-succinyltransferase
     A3780_12940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: APG18419
Position
2827655..2828731
Genome map
AA seq 358 aa AA seqDB search
MFFRIISGTTLAILLALSPLSHAANSAPTVQEGDWVANEFTFNSGEKLNDLRIHYYTLGD
RSKPAVLLLHGTNQPIKALLAPGFAGELFAPGAALDSSKYFIIIPESIGSGKSSKPSDGL
RMNFPHYDYDDMVTAQYRLIKEGLGISHLRLVMGYSMGGMQTWLWGEKYPTMMDALVPMA
SQPNELSGRNWMMRRMLIESIKADPAWAQGNYQQQPPALKTANIMFSIATTGGTLNYQHK
APTRALADKLVDERLAAPVTADANDFIYIWGSSANYNALPALNRITAPMLIINSADDERN
PVETGILSGELHKIKQAELFLIPASVETSGHGTMMSAKFYRDKLRAFLAATPQRQDKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttctttcgcataatatcaggaacgacactcgccattctgttagctttatcaccttta
tctcacgcagcaaattcagcacccactgttcaggaaggcgactgggtcgccaacgaattt
acctttaatagcggtgaaaaactcaacgatctgcgtattcattactacacgctcggcgat
cgcagcaaacctgcggtattactcctgcacggaacgaaccagccgattaaagcgttgctg
gcgccaggatttgccggtgagttatttgcccccggcgcagcgctcgatagcagtaaatat
ttcatcatcatcccggaaagtattggctcggggaaatcctccaagccgtcagatggtttg
cgcatgaactttccgcactacgattatgacgatatggtgaccgcacaatatcgcttaatt
aaagaaggcctcggtatttcgcatttgcgcctggtgatgggttattcaatgggcggtatg
cagacctggctgtggggagaaaaatacccgacgatgatggatgcgctggtgccgatggcc
tcgcagcctaacgagctttctggccgtaactggatgatgcggcgcatgttaattgagtcg
atcaaagccgatccggcctgggcgcagggcaattaccagcagcaaccgcctgcgctgaag
accgccaatattatgttcagtattgccaccaccggcggcacgctgaattaccagcataaa
gcgccaacccgcgccctggccgataaactggtggatgagcgtctggccgcaccggtcact
gcggatgccaacgactttatttatatctggggctcctcggcgaactataacgccttacca
gcgttaaaccgtattaccgcgccgatgctgatcattaactccgccgatgatgaacgtaat
ccggtagaaaccgggatcctcagtggcgaactccacaaaataaaacaggctgagcttttt
cttattccggccagcgtggaaaccagcggccacggcaccatgatgtcggcaaaattttac
cgcgacaaactgcgcgcttttttggccgccacacctcaacggcaggataaaaagtaa

DBGET integrated database retrieval system