KEGG   Kosakonia radicincitans: A3780_16235Help
Entry
A3780_16235       CDS       T04579                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
krd  Kosakonia radicincitans
Pathway
krd00480  Glutathione metabolism
krd00590  Arachidonic acid metabolism
krd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A3780_16235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A3780_16235
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A3780_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: APG19040
Position
3554268..3554750
Genome map
AA seq 160 aa AA seqDB search
MTPFHQLTATSLGGQLISMADYAGKVVLVVNTASLCGFTPQYGGLESLYQKYAARGLVVL
GFPCNQFGKQEPGGAEDIAQTCHINYGVSFPMFQKVEVNGSAAHPLFRYLKNELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMEATILAALEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactccctttcatcaacttacagccaccagtctgggcggccagcttatctctatggcc
gactacgcaggtaaggtggttctggtcgttaataccgccagcctttgtggcttcacgcca
caatacggaggccttgaatcgctctaccagaaatacgccgcccggggtttggtggtgctt
ggtttcccctgcaaccagtttggtaaacaggagcccggcggcgccgaagacatcgcgcaa
acctgtcacattaattacggtgtgagctttccgatgttccagaaagttgaggtcaacgga
agtgcagcgcacccgctgtttcgttatctgaaaaacgaattgcccggcgtgctgggtggg
cggatcaagtggaacttcactaaattcctgatcggacgcgacggtaaaccgctcaagcgt
tttgcgccgttcaccaccccggagaaaatggaagccacaatccttgcggcacttgaaatt
taa

DBGET integrated database retrieval system