KEGG   Kosakonia radicincitans: A3780_18270Help
Entry
A3780_18270       CDS       T04579                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd00500  Starch and sucrose metabolism
krd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_18270
   00500 Starch and sucrose metabolism
    A3780_18270
Enzymes [BR:krd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     A3780_18270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: APG19409
Position
3990687..3992096
Genome map
AA seq 469 aa AA seqDB search
MASTTLLPAMLQAVMKGQPKALADPHYPAWHLAPVTGLLNDPNGFIQFAGRYHLFYQWNA
LGCQHLHKCWAHWSSADLVHWQHEPIALMPDEEYDRNGCYSGSAIDNNGVLTLCYTGNVK
FDDGSRTAWQCLAVQNSDGGFDKLGPAIPLPHGYTGHVRDPKVWRHDGQWYMVLGAQDLQ
LQGKVLLLRSENLWNWQNLGEIAGSDLNELGDAGYMWECPDMFTLGDRTFLICCPQGVAR
EEKRYLNTYPSAYLSGTLDYASAQYQHGEFTELDAGFEFYAPQTTLADDGRRLLVGWMGV
PDGEEMLQPTVANGWIHQMTCLRELTEHNGKLYQQPVAELQALRGEEQRYRGTAEAMTAL
EAEQLELVLESEGGLTLNFADTLILEWRGDELRLARRSLQTGEWLYRYWRGSAQKLQILC
DRSSVEIFINEGEGVMSSRYFPTHPAQLTLRGGAEVQAHYWSLRSCMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacaaccctgctgcctgccatgttgcaggcagtaatgaaaggccagccgaaa
gcgctggcagacccgcactaccccgcctggcatcttgcgccggtgaccgggctgcttaac
gatccgaacggttttatccagttcgccgggcgttatcatctgttctaccagtggaatgcg
ctggggtgtcagcacctgcacaaatgctgggcgcactggagttcggcggatttagtccac
tggcaacatgaaccgatcgcgctgatgcccgacgaagagtatgaccgcaatgggtgctac
tccggcagcgccattgataacaatggcgtactgacgctgtgctacaccggcaacgtgaag
tttgacgatggttcccgcaccgcgtggcagtgcctggcggtacaaaacagcgacggcggt
ttcgacaagctcggcccggccattccgttgccgcacggctacaccggccatgtgcgcgac
ccgaaagtgtggcggcacgacgggcaatggtacatggtgctgggcgcgcaggatttacag
ttgcagggcaaggtgctgctgctgcgctcagagaatttgtggaactggcaaaacctcggt
gaaatcgccggtagcgacctgaacgagctgggcgatgcgggctatatgtgggagtgcccg
gatatgttcaccctcggcgaccgcacctttctgatctgctgcccgcagggcgtagcgcgt
gaggagaaacgctacctcaatacctacccgagcgcctatctcagcggtacgctggattac
gccagcgcgcagtatcagcacggtgagtttaccgaactggatgccgggtttgagttttac
gccccgcaaaccacgctcgccgatgatggccgccgcctgctggtcggctggatgggcgta
ccggatggcgaagagatgttacagccaaccgtggcgaatggctggatccaccagatgacc
tgcctgcgtgaactgactgaacataacggtaagctctatcagcagccggttgctgagcta
caggcgctgcgcggtgaagaacagcgctatcgcggtacggcagaagcgatgactgcgctg
gaggcagagcaacttgagctggtgctggaaagcgagggcgggttaacgctgaatttcgcc
gatacgctcattctcgaatggcgcggcgacgaactgcgtctggcccgtcgcagcctgcaa
accggcgagtggctgtaccgttactggcgcggcagcgcgcagaagttgcagatcctctgc
gatcgctcaagcgtggagatctttatcaacgagggcgaaggggtgatgagcagccgctat
ttcccgacgcatccggcgcaattaaccctgcgcggaggcgcagaagtacaggcccactac
tggtcgttacgttcttgcatggtagaataa

DBGET integrated database retrieval system