KEGG   Kosakonia radicincitans: A3780_24125Help
Entry
A3780_24125       CDS       T04579                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
krd  Kosakonia radicincitans
Pathway
krd00540  Lipopolysaccharide biosynthesis
krd01100  Metabolic pathways
Module
krd_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A3780_24125 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:krd01005]
    A3780_24125 (rfaD)
Enzymes [BR:krd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     A3780_24125 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:krd01005]
 Unusual sugar
  A3780_24125 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR adh_short Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: APG20502
UniProt: A0A5E8BY17
Position
5200789..5201721
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLHIADYMDKEDFLIQI
MAGEEFGDIDAVFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEKPLNVYGYSKMLFDEYVRSILPEANSPVVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDNFKRDFVYVGDVAAVNLWFWENGVSGIYNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPEKLKGRYQAFTQADLTNLRKAGYDKPFKTVAEGVT
EYMAWLNRDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttaccggcggcgcgggttttatcggcagtaacattgttaaagccctgaat
gataaaggcatcactgatattctggtggtggacaacctgaaagacggtaccaagtttgtc
aatctggttgacctgcacatcgccgactacatggataaagaagacttcctgatccagatt
atggccggggaagagttcggcgacattgacgcggtattccacgaaggtgcgtgctcctcc
acgacagagtgggacggcaagtacatgatggataacaactatcagtactctaaagagctg
ctgcattactgcctggaacgtgaaatccccttcctgtatgcctcttccgcagccacgtac
ggcggtcgaacttccgacttcattgaatcccgcgagtatgaaaaaccgctgaacgtttac
ggctactcaaaaatgctgtttgacgaatatgtgcgcagcattctgccggaagcgaattca
ccggttgtcggtttccgctatttcaacgtttatggtccgcgtgaaggccacaaaggcagc
atggcaagcgtggctttccatctcaatacccaactgaacaacggtgaaagcccgaaactg
ttcgaaggtagcgataactttaagcgcgacttcgtctacgttggcgatgtggccgccgtg
aatctgtggttctgggaaaacggcgtttccggtatttataacctcggcactggccgcgca
gaatctttccaggcggttgcggatgcgacgctggcttaccataagaaaggttctattgag
tacattccgttccccgagaaactgaaaggtcgctaccaggcgtttacccaggcggatctt
actaacctgcgcaaagcgggctatgacaagccatttaaaaccgttgccgaaggcgtcacc
gagtatatggcctggctgaaccgcgacgcgtaa

DBGET integrated database retrieval system