KEGG   Kosakonia radicincitans: A3780_24435Help
Entry
A3780_24435       CDS       T04579                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
krd  Kosakonia radicincitans
Pathway
krd00633  Nitrotoluene degradation
krd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A3780_24435
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     A3780_24435
  1.-  
   1.-.-  
    1.-.-.-  
     A3780_24435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Trypsin
Motif
Other DBs
NCBI-ProteinID: APG20559
Position
5263693..5264346
Genome map
AA seq 217 aa AA seqDB search
MTLDDAVVARHTVKAFEPGQTLPQDKIETLLNVLQNSPSSVNSQPWHFVVASTAQGREAI
AKSTTGAFAYNEPKVLNASHVIALCIRSDIDDKHLQNVLAQEQKDGRFVAEGAQAGQDKS
RRSYVDMHRYELRDLPQWMEKQVYLALGGLLLGAAMLGIDATPMEGFDQRALDLSLGLRE
KGLTSVVLVSLGVRSDKDFNAALPKSRLPRDEIFTFI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgatgatgccgtcgttgcccgccataccgtaaaagcattcgaacccggccag
acgctgccgcaggataaaatcgaaacgctgctgaacgtgctgcaaaacagcccctcctcc
gttaactcgcagccgtggcactttgttgtcgcctccacggcgcaagggcgtgaagccatt
gctaaatccaccaccggcgcttttgcctataacgagccgaaagtcctgaacgcctctcat
gtgattgcgctgtgcatccgcagtgatattgacgacaaacacctgcaaaacgttctcgcg
caggagcagaaagatggccgctttgtcgcagaaggcgcgcaggcgggccaggataaaagc
cgccgttcttacgtcgatatgcatcgctacgaactgcgcgatctgccgcagtggatggag
aaacaggtgtacctggcgttaggcggcctgctgctgggcgcggcaatgcttggcattgac
gccacgccaatggaaggttttgaccagcgcgcgctggatctgtcgctgggcctgcgtgaa
aaagggctgaccagcgtggtgctggtctcgctcggcgtgcgcagcgataaagacttcaac
gccgccctgccgaaatcccgcctgccgcgcgacgaaatcttcacctttatctaa

DBGET integrated database retrieval system