KEGG   Kosakonia radicincitans: A3780_24490Help
Entry
A3780_24490       CDS       T04579                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
krd  Kosakonia radicincitans
Pathway
krd00071  Fatty acid degradation
krd00072  Synthesis and degradation of ketone bodies
krd00280  Valine, leucine and isoleucine degradation
krd00310  Lysine degradation
krd00362  Benzoate degradation
krd00380  Tryptophan metabolism
krd00620  Pyruvate metabolism
krd00630  Glyoxylate and dicarboxylate metabolism
krd00640  Propanoate metabolism
krd00650  Butanoate metabolism
krd00900  Terpenoid backbone biosynthesis
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
krd01130  Biosynthesis of antibiotics
krd01200  Carbon metabolism
krd01212  Fatty acid metabolism
krd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:krd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3780_24490
   00630 Glyoxylate and dicarboxylate metabolism
    A3780_24490
   00640 Propanoate metabolism
    A3780_24490
   00650 Butanoate metabolism
    A3780_24490
  Lipid metabolism
   00071 Fatty acid degradation
    A3780_24490
   00072 Synthesis and degradation of ketone bodies
    A3780_24490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3780_24490
   00310 Lysine degradation
    A3780_24490
   00380 Tryptophan metabolism
    A3780_24490
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3780_24490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3780_24490
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3780_24490
Enzymes [BR:krd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3780_24490
Exosome [BR:krd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3780_24490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APG20570
Position
complement(5275125..5276312)
Genome map
AA seq 395 aa AA seqDB search
MKDTDIVILGAARTAIGSLNGSLANISSPKLGSIVIKSLLEKSHIPVKEVDEVIIGQVLT
AGCGQNPARQTLIHSGISQDVPALTINKVCGSGMKALQLAYQSLKCGEAELIIAGGQENM
SQSPHILPHSRNGMKMGNWEMQDSMVNDGLWDAFHDYHMGMTAENIAEKYGITREEQDEF
ALASQRKAAAALEASRFVSEIVPVVIIKPGKDTIVVEKDEFPRPQTTREGLAKLRPAFKK
EGTVTAGNASGVNDGAAMVILATAKKARELGITPLGRIVEFATSGVAPEIMGTGPIEASR
NVLKKSNWQVSNLDLIEANEAFAAQAIAVNREMGWDLTKVNVNGGAIALGHPIGASGARI
FVSLIHEMQRRKSKKGLATLCIGGGMGIAVTVEMD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatactgatattgttatacttggcgcagcaaggacagctattggctcgcttaat
ggttcccttgccaatatatcctcacctaaactgggatctatagtgattaaatcacttctt
gaaaagtctcatattccggtaaaagaagtggatgaggttatcattggtcaggttttaacg
gcggggtgtgggcaaaatccagcgcgacaaacattaattcattccggtatttcacaggat
gttcccgcactgacaattaataaagtttgtggctcaggaatgaaagcattacagcttgca
tatcagtcattaaagtgcggtgaagctgagctgattattgcgggcgggcaggaaaatatg
agtcagtcgccgcatattcttcctcactcccgtaatggaatgaaaatgggtaactgggaa
atgcaggacagcatggttaatgatggattatgggatgcattccatgattatcacatgggg
atgactgcggaaaatatcgcggagaaatatggtattacgcgtgaagagcaggatgaattt
gcgctggcctcgcaacgtaaagccgctgctgcccttgaggcttcccgttttgtcagtgag
attgtgccggttgttattatcaaacccggtaaagataccatcgtagttgaaaaagatgaa
tttccgcgtccacaaaccacgcgtgaagggctggcaaaactacgcccggctttcaagaaa
gagggaaccgtaaccgccggcaacgcttccggggtaaatgatggcgcggccatggttatt
ttggctaccgcgaaaaaagccagagaactgggtattacaccgcttggccgaatcgttgaa
tttgcaacctcaggcgttgcaccggaaataatgggaaccgggccgattgaagcttcccga
aatgtacttaaaaaatcaaactggcaggtcagcaaccttgatcttattgaagccaatgaa
gcgtttgcggcgcaggctatcgcggttaaccgtgaaatgggctgggatctgacgaaagtg
aatgttaatggcggtgccattgctctcggtcaccctattggcgcgtctggcgcccgtatt
tttgtgtcgttaattcatgaaatgcagcgccgaaaaagtaaaaaaggtctggcgacatta
tgcattggcggcggcatgggcattgctgtcacggttgagatggattaa

DBGET integrated database retrieval system