KEGG   Kosakonia radicincitans: A3780_26060Help
Entry
A3780_26060       CDS       T04579                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
krd  Kosakonia radicincitans
Pathway
krd00270  Cysteine and methionine metabolism
krd00920  Sulfur metabolism
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01130  Biosynthesis of antibiotics
krd01230  Biosynthesis of amino acids
Module
krd_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A3780_26060
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A3780_26060
Enzymes [BR:krd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A3780_26060
    2.3.1.46  homoserine O-succinyltransferase
     A3780_26060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: APG20842
Position
5612131..5613060
Genome map
AA seq 309 aa AA seqDB search
MPIRVQDELPAVNFLRDENVFVMTTSRATVQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDVRLLRIDSRESRNTPAEHLNTFYCNFDEICHENYDGLIVTGAPLGLVEFNDVAY
WPQIEQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRSEKLSGVYEHHILHPHALLT
RGFDDVFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDA
NTLANEYFRDVEAGLSPELPHNYFPKDDPQNKPRASWRSHGNLLFINWLNYYVYQITPYD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgggtgcaggacgagctgccagccgtcaatttcttgcgtgacgagaacgtc
tttgtgatgacgacttcgcgcgcgacagttcaggagatccgccctctgaaggtgttgatc
ctgaacctgatgccaaagaagattgagacggaaaaccagttcctgcgtctgctgtcgaac
tcaccgctacaggtcgatgtgcgcctgctgcgcatcgattcccgcgagtcgcgtaatacg
ccagctgagcacctgaataccttttactgtaattttgatgaaatctgccacgaaaactac
gatggcctgattgttaccggcgcgccactgggcctggttgagtttaacgatgttgcctac
tggccgcagatcgagcaggtactggaatgggcgaaagatcacgttacctcaacgctgttt
gtctgttgggcggtacaggccgccctcaatattctttatggcattcccaagcagacccgc
agtgaaaagctctccggcgtttatgaacaccacatccttcatccccatgcgctgttgacg
cgcggttttgacgatgtattccttgctccgcactcccgctatgcagatttcccggcggca
ctgatccgcgattacaccgatctggagatcctggccgaaacagaagagggcgatgcctac
ctgtttgccagcaaagataaacgcattgctttcgtgaccggccacccggagtacgacgcc
aacacgctggcgaatgaatattttcgcgatgtggaagcgggcctcagtcctgagctgccg
cataactacttcccgaaagatgacccgcagaataaaccgcgcgcctcctggcgcagccac
ggcaatctgctgttcatcaactggctcaactactacgtctaccagatcacgccatacgat
ctgcgtcacatgaatccgacgctggattaa

DBGET integrated database retrieval system