KEGG   Kocuria rhizophila: KRH_01700Help
Entry
KRH_01700         CDS       T00701                                 

Gene name
echA
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
krh  Kocuria rhizophila
Pathway
krh00071  Fatty acid degradation
krh00280  Valine, leucine and isoleucine degradation
krh00310  Lysine degradation
krh00360  Phenylalanine metabolism
krh00362  Benzoate degradation
krh00380  Tryptophan metabolism
krh00410  beta-Alanine metabolism
krh00627  Aminobenzoate degradation
krh00640  Propanoate metabolism
krh00650  Butanoate metabolism
krh00903  Limonene and pinene degradation
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KRH_01700 (echA)
   00650 Butanoate metabolism
    KRH_01700 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    KRH_01700 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KRH_01700 (echA)
   00310 Lysine degradation
    KRH_01700 (echA)
   00360 Phenylalanine metabolism
    KRH_01700 (echA)
   00380 Tryptophan metabolism
    KRH_01700 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KRH_01700 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KRH_01700 (echA)
   00281 Geraniol degradation
    KRH_01700 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KRH_01700 (echA)
   00627 Aminobenzoate degradation
    KRH_01700 (echA)
   00930 Caprolactam degradation
    KRH_01700 (echA)
Enzymes [BR:krh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KRH_01700 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAG28517
NITE: KRH_01700
UniProt: B2GKY0
Position
188804..189586
Genome map
AA seq 260 aa AA seqDB search
MTENTYDTILVRREGRVGVITLNRPKALNALNVQTMTELVAAATDLDRDPEIGAIVLTGS
EKAFAAGADIKEMGSKTGSDMYREDFFSAWDTFARLRTPKIAAVSGYALGGGCEAAMMCD
MIIAADTAKFGQPEITLGVIPGMGGTQRLTRAVGKAKAMDLILTGRQMDAEEAERSGLVS
RVVPADSLMDTALEVAAKIGSMSKPVAQHAVETVNTAYETTLAAGLQYERRVFHGLFSTA
DQKEGMAAFTEKRKPNFSHE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaacacctacgacaccatcctggtccgccgcgagggacgcgtgggcgtgatc
acgctgaaccgccccaaggcgctgaacgcgctgaacgtgcagaccatgaccgagctcgtg
gcggccgccaccgacctggaccgcgatccggagatcggcgcgatcgtcctgaccggctcc
gagaaggcgttcgccgcgggcgccgacatcaaggagatgggctccaagaccggttcggac
atgtaccgcgaggacttcttctccgcgtgggacaccttcgcccggctgcgcactccgaag
attgccgcggtctcgggctacgccctgggcggtggctgcgaggcggccatgatgtgcgac
atgatcatcgccgcggacaccgccaagttcgggcagccggagatcaccctgggcgtcatc
ccgggcatgggcggcacgcagcggctcacccgtgcggtgggcaaggccaaggcgatggac
ctcatcctcaccggccgccagatggacgccgaggaggccgagcgctccggactcgtctcc
cgcgtggttcccgccgactccctcatggacaccgcgctggaggtcgccgcgaagatcggt
tccatgtccaagccggtggcccagcacgccgtggagacggtgaacaccgcgtacgagacc
accctggccgccggcctgcagtacgagcgccgcgtgttccacgggctgttctccactgcg
gaccagaaggagggcatggcggccttcacggagaagcggaagccgaacttctcccacgag
tga

DBGET integrated database retrieval system