KEGG   Kocuria rhizophila: KRH_19040Help
Entry
KRH_19040         CDS       T00701                                 

Definition
(GenBank) putative inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
krh  Kocuria rhizophila
Brite
KEGG Orthology (KO) [BR:krh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KRH_19040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAG30251
NITE: KRH_19040
UniProt: B2GG50
Position
2188015..2189040
Genome map
AA seq 341 aa AA seqDB search
MTDVLAFAGVVLTLIFTVVNGFHDASNAVALPVRFNALTPRVALWLGAVFNMMGALLVGL
VLNRMITFEIPVPLGLVGAVALICALVTAIGWDLITWWWRMPASSTAAIGGAVVGALLGA
RAVDLHGHELALGPYFSWNVLVPMLVSPLIAFALAFVLVIPLVHMVQHQAPGRVNFRAGV
VQATGAAAIHFGHGIQHARRALWILVVLLLIAGSGISRQSIPLWLSALVGLCLAVGTLMG
GWRISYTLSSRVVSLDPLRGAIAQTVSGALLFVGAFLSPIPLSSSQTSTAAILGAGSAQK
FRTVYHATLVRVVATWLFTVPVCGLVSAVLFLAVSPLLPAP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgctggccttcgcgggcgtggtcctcacgctgatcttcaccgtggtcaac
ggcttccacgacgcctccaacgcggtggccctgcccgtgcgcttcaacgcgctcacaccg
cgcgtggccctgtggctgggcgcggtgttcaacatgatgggtgcgctgctggtgggcctc
gtgctgaaccgcatgatcacgttcgagatccccgtgcccctcggcctcgtgggtgcggtg
gcgctgatctgcgcgcttgtcacggccatcggctgggacctgatcacgtggtggtggcgg
atgccggcgtcctccaccgcggccatcggcggcgccgtggtaggggccctgctcggcgcc
cgcgcggtggacctgcacggccacgagctcgccctggggccctacttctcctggaacgtg
ctggtccccatgctcgtgtccccgctgatcgcgttcgccctcgcgttcgtgctggtgatc
cccctggtccacatggtccagcaccaggcccccggccgggtgaacttccgcgccggggtg
gtgcaggccacgggcgcggcggccatccacttcggccacggcatccagcacgcccggcgc
gccctgtggatcctggtggtgctgctcctgatcgccggctccggcatctcccgccagagc
atccccctgtggctcagcgcgctggtgggcctgtgcctcgcggtcggcaccctcatgggc
ggctggcggatctcctatacgctctcctcccgggtggtctccctcgatccgctgcgcggg
gcgatcgcccagaccgtctcgggcgcgctgctgttcgtgggggcgttcctctcccccatc
ccgctgtccagctcgcagaccagcacggccgcgatcctgggcgcaggctcggcgcagaag
ttccgcaccgtctaccacgccaccctggtgcgcgtggtggccacgtggctcttcaccgtg
ccggtgtgcgggctggtgtccgcggtgctgttcctggccgtctccccgctgctgcccgcg
ccctga

DBGET integrated database retrieval system