KEGG   Kocuria rhizophila: KRH_21730Help
Entry
KRH_21730         CDS       T00701                                 

Gene name
ureA
Definition
(GenBank) urease gamma subunit
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
krh  Kocuria rhizophila
Pathway
krh00220  Arginine biosynthesis
krh00230  Purine metabolism
krh01100  Metabolic pathways
krh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KRH_21730 (ureA)
  Amino acid metabolism
   00220 Arginine biosynthesis
    KRH_21730 (ureA)
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    KRH_21730 (ureA)
Enzymes [BR:krh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     KRH_21730 (ureA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_gamma
Motif
Other DBs
NCBI-ProteinID: BAG30520
NITE: KRH_21730
UniProt: B2GI08
Position
complement(2500363..2500665)
Genome map
AA seq 100 aa AA seqDB search
MHLQPKDQEKLLVVVAADLARRRQARGLKLNHPEAIAIITYELLEGARDGRTVAELMSWG
STILSREDVMEGVPEMIPDVQVEATFPDGTKLVTVHDPIR
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgcagcccaaggaccaggagaagctcctggtggtggtcgccgcggacctcgcg
cgcaggcgccaggcgcgtgggctgaagctgaaccaccccgaggccatcgcgatcatcacg
tacgagctcctcgagggggctcgggacgggcgcaccgtggcggagctgatgagctggggc
agcaccatcctcagccgggaggacgtcatggagggcgttcccgagatgatcccagacgtc
caggtggaggccacgttcccggacggcaccaagctcgtgaccgtccacgatcccatccgc
tga

DBGET integrated database retrieval system