KEGG   Kocuria rhizophila: KRH_22550Help
Entry
KRH_22550         CDS       T00701                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
krh  Kocuria rhizophila
Pathway
krh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KRH_22550
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KRH_22550
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KRH_22550
    1.1.1.-  
     KRH_22550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAG30602
NITE: KRH_22550
UniProt: B2GIS5
Position
complement(2586008..2587084)
Genome map
AA seq 358 aa AA seqDB search
MRAARYYGRNDIRIDELPEPEVGPGMVGIDVAWCGICGTDLHEYLEGPIFCPTPDTPHPI
SGETAPVTMGHEFSGVIYELGDGVGDLRVGQHVVVEPYIIGEDVDTGPESKDYHLSRDMN
FIGLAGGGGGLGEKIAVRRRWVHPVSDVVPLDQAALIEPLSVGYHAAERSGAKAGDVAVV
GGAGPIGLLTAAVLKALSVTVVVSELSPLRRQKALDTGVADYALDPREVDVAQEVRRLTN
GKGADVAFECTSVQVVLDTLMDVLRPTGVLVVVSIWGKRADFDMHKLVMKEIDLRGTIAY
VNSHPATIELVESGKIDLAPFITGKIGVDGLVEEGFETLIHRNETAVKILVSPSGEGL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcgcgctactacggacgcaatgacattcgaatcgacgaactgcccgagccc
gaggtcggtcccggcatggtgggaatcgatgtcgcgtggtgcggcatctgcggcaccgac
ctccacgagtacctcgagggcccgatcttctgtcccaccccggacacccctcatccgatt
tccggcgagaccgcgcctgtgaccatgggacatgaattctccggggtgatctacgagctc
ggcgacggagtgggcgatctgcgggtgggccagcacgtggttgtggagccctacatcatc
ggcgaggacgtggacaccgggcccgagagcaaggactaccacctctcccgcgacatgaac
ttcatcggcctggccggaggcgggggtggtctcggcgagaagatcgctgtgcggcgtcga
tgggtgcaccccgtgtctgatgttgtgccactggaccaggccgccctgatcgaaccgctc
tcggtgggataccacgcggcggagcgctccggggccaaggccggggacgttgccgttgtg
ggcggcgccgggcccatcggcctcctgaccgctgcggtgctgaaggccctgagcgtcacc
gtggtcgtgtccgagctcagcccgctgcggcggcagaaggccttggatacgggcgtggct
gactacgccctggatccccgggaggtagatgtcgcccaggaggtccgaaggctcacgaac
ggcaagggcgcggacgtggccttcgagtgcaccagtgtgcaagtggtgctggacaccctc
atggatgtactacggcccaccggcgtgctcgtggtcgtatccatctggggcaagcgcgcg
gactttgacatgcacaagctcgtgatgaaggagatcgacctacggggcaccatcgcctat
gtgaactcgcacccggccaccatcgaactggtggaatccgggaagatcgacctggcgccg
ttcatcaccggcaagatcggggtggacggtctggtggaggagggtttcgaaaccctgatc
catcgcaatgagaccgcggtcaagatcctggtctcaccctccggggaggggctctga

DBGET integrated database retrieval system