KEGG   Ketogulonicigenium robustum: BVG79_00319Help
Entry
BVG79_00319       CDS       T04841                                 

Gene name
phhB
Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00790  Folate biosynthesis
kro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVG79_00319 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kro04147]
    BVG79_00319 (phhB)
Enzymes [BR:kro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BVG79_00319 (phhB)
Exosome [BR:kro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVG79_00319 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ARO13675
UniProt: A0A1W6NWS6
Position
complement(314506..314781)
Genome map
AA seq 91 aa AA seqDB search
MHPDGLDALLQTDWALDADGRAITRSFTFSDFNAAFGFMTRAALVAEKLNHHPEWTNVYK
RVDVRLTTHDAGGLSDMDVKLARKMNDFAGQ
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgatggattggacgcattgctgcaaaccgactgggcgcttgacgccgatggc
cgcgcgatcacccgcagcttcacgtttagcgacttcaacgcggcgttcggctttatgacg
cgcgctgcgctggtggccgagaaactgaaccaccaccccgaatggaccaatgtctacaaa
cgggtcgatgtgcgcctgaccacccatgatgcgggcggcctgtcggatatggacgtgaaa
ctggcccgcaaaatgaacgacttcgcgggccagtag

DBGET integrated database retrieval system