KEGG   Ketogulonicigenium robustum: BVG79_01711Help
Entry
BVG79_01711       CDS       T04841                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00860  Porphyrin and chlorophyll metabolism
kro00970  Aminoacyl-tRNA biosynthesis
kro01100  Metabolic pathways
kro01110  Biosynthesis of secondary metabolites
kro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BVG79_01711 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BVG79_01711 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kro01007]
    BVG79_01711 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kro03016]
    BVG79_01711 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:kro02048]
    BVG79_01711 (gltX)
Enzymes [BR:kro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BVG79_01711 (gltX)
Amino acid related enzymes [BR:kro01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BVG79_01711 (gltX)
Transfer RNA biogenesis [BR:kro03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BVG79_01711 (gltX)
 Prokaryotic Type
   Other AARSs
    BVG79_01711 (gltX)
Prokaryotic defense system [BR:kro02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BVG79_01711 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c NMT1
Motif
Other DBs
NCBI-ProteinID: ARO15055
UniProt: A0A1W6P0L6
Position
1711193..1712599
Genome map
AA seq 468 aa AA seqDB search
MSDTKPVVTRFAPSPTGSLHIGGARTALFNWLFARGRGGKFLLRIEDTDRSRSTPENTAE
ILAGLTWLGIDWDGEPISQFERAPRHAEVARELLASGKAYKCFSTTEEIEAFREQARAEG
KSTLFRSPWRDVPESEHPDLPFVIRIKAPQDGAQTITDQVQGEVTIGNDQMDDMVMLRSD
GTPVYMLAVVVDDHDMGVTHVIRGDDHLTNAFRQKMIYDAMGWDFPVMAHIPLIFGPDGK
KLSKRHGATAAAEYQAMGYPAAGMRNYLTRLGWSHGDAEFFTDAEARAWFDLEGIGKSPA
RFDTKKLEHLCGMHIARSDDADLVAQIKGYLAKIGAAPLTDAQADGLLRAMYTLKERAKT
FPELLEKAHFVLTQRPIVPDEKAAAALDTVSRGILNELTQLLPDVSWERDTLETLVAEVA
EKHGTKLGKIAAPLRTALAGRSVSPSVFDMMLILGRTESTARLAEASS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccaaacccgtcgtcacccgctttgccccctcgcccaccggatcgctgcat
atcggcggcgcgcgcacggcgctgttcaactggctgttcgcgcgcgggcgcggcggtaaa
ttcctgctgcggatcgaggacaccgaccgcagccgctcgacccccgaaaacaccgccgaa
attctggcgggcctgacgtggttggggatcgattgggacggcgagccgatcagccagttc
gagcgcgccccccgccatgccgaggtcgcgcgcgaactgctggcgagcggcaaagcctac
aaatgcttttcgacgaccgaagaaatcgaagccttccgcgaacaggcccgggctgagggc
aagtcgacgctgttccgctcgccttggcgcgatgtgcctgaaagcgaacacccggacctg
cccttcgtcattcgtatcaaagccccgcaagacggcgcccaaaccatcaccgaccaagtt
cagggcgaagtgaccatcggcaatgaccagatggacgatatggtcatgctgcgctcggac
ggcactccggtctatatgctggccgtggtggtcgatgatcatgatatgggcgtcacgcat
gtcatccgcggcgacgaccacctgaccaacgcgttccgtcaaaagatgatctacgacgcg
atgggctgggattttcccgtcatggcgcacattccgctgattttcgggcccgacgggaaa
aagctgtcgaaacggcacggcgcgacggccgccgccgaataccaagccatgggctacccc
gccgccggcatgcgcaactacctgacccgcttgggttggagccatggcgatgccgaattc
tttaccgatgccgaggcgcgcgcttggttcgatctggaaggcatcggcaaatcacccgcc
cgtttcgacaccaaaaagctggaacacctgtgcggtatgcatatcgcccgcagcgatgac
gccgatctggtcgcccaaatcaagggatatttggccaaaatcggcgccgcgcccctgaca
gatgcgcaagccgacgggctgctgcgcgcgatgtataccctgaaggaacgcgccaaaacc
ttccccgaattgctggaaaaggctcatttcgtcctgacccaacgccctatcgtccccgac
gagaaagcggcggcggccctcgatactgtatcccgtggcatactgaacgaattgacgcag
ctgttgccggatgttagctgggaacgcgacacgcttgaaacgctggtcgccgaggttgcc
gaaaagcatggaaccaagctgggcaagattgcagcccccttgcgaacagcgcttgccggg
cgcagcgtaagcccaagcgtattcgacatgatgctgattctgggccgcacggaatcgacc
gcgcgcctggccgaggcctcgtcctaa

DBGET integrated database retrieval system