KEGG   Ketogulonicigenium robustum: BVG79_p1000037Help
Entry
BVG79_p1000037    CDS       T04841                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00730  Thiamine metabolism
kro00790  Folate biosynthesis
kro01100  Metabolic pathways
kro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BVG79_p1000037 (phoA)
   00790 Folate biosynthesis
    BVG79_p1000037 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BVG79_p1000037 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kro04147]
    BVG79_p1000037 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kro00537]
    BVG79_p1000037 (phoA)
Enzymes [BR:kro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BVG79_p1000037 (phoA)
Exosome [BR:kro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVG79_p1000037 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kro00537]
 Enzymes
  BVG79_p1000037 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ARO15839
UniProt: A0A1W6P330
Position
unnamed1:complement(45061..46494)
Genome map
AA seq 477 aa AA seqDB search
MKSLKLAALALLASSALVAPALAQDHAKNIIVLITDGAGPESWNAASYYRHGALGHEAYD
GFDLKAYMATHPLNTSSEPTFSDEGSVTFDPTELWTDTAVDTVYEGALGNYAGYFSGYDY
ARADYTDSAAAATALASGQKTYNNSINWSNNGESLRHIGEYAVESGRALGVVSSVQISHA
TPAGYLAHNVSRNDYVAIGTEIVDSGLATVVLGTGHPMFDAAGKPVAEPADGAFRYIGGR
DTFARLTAGETDYQFIETREDFEALANGTFEMTGDKILGLVQNNATLQFNRPGVGFGDLL
ENSPSLPTLTAAALNVLAKDEDGFFLMVEGGAVDWAAHANNLPRLIEEQIDFNMAIETAV
KWVEANSNWDETLIIVTTDHGNGLLAGPQSDTIAYQPIVNQGQGAMPLVRWHSDTHTREL
VPLFAHGAGSEYFRTNAAAEAGLARYGVDEAAQIWVDNTDIFHGAMAAMGIEEVAAN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccctcaagctcgccgctcttgccctgctggcctcctccgcacttgtcgcgccc
gcacttgcccaagaccacgcgaaaaacatcatcgttctgatcactgacggtgccggcccc
gaaagctggaatgccgccagctactaccgccacggcgcattgggccacgaggcctacgac
ggctttgacctgaaggcctatatggccacgcatccgctgaacacctcgtccgagccgacc
tttagcgacgaaggttcggtcaccttcgacccgaccgaattgtggaccgacaccgctgtc
gacaccgtttatgaaggcgcccttggcaactacgccggctacttctcgggctacgactat
gcccgtgccgattacaccgactcggccgccgcagcgaccgcgctggcctcgggccaaaag
acctacaacaactcgatcaactggtcgaacaacggcgaatcgctgcgccacatcggcgaa
tatgccgttgaatcgggccgtgcgcttggcgtggtgtcgtcggttcaaatcagccacgcg
acgcccgcaggctatctggcccacaatgtcagccgtaacgactatgtcgccatcggcacc
gaaatcgtcgacagcggcctcgccaccgtcgtgctgggcaccggccacccgatgttcgac
gccgctggcaaacccgttgccgaacccgctgacggcgccttccgctacatcggcggccgc
gacactttcgcccgcctgaccgctggtgagaccgactaccagttcatcgaaacccgcgaa
gacttcgaagcgctggccaacggcaccttcgagatgaccggcgacaagatcctcggcctt
gtgcagaacaacgcgacgctgcagttcaaccgcccgggcgtcggcttcggcgacctcctc
gaaaactcacccagcctgccgacgctgacggccgccgcgctgaacgtgctcgccaaagac
gaagacggcttcttcctgatggtcgaaggcggcgctgttgactgggctgcccacgcaaac
aacctgccgcgcctgatcgaagagcaaatcgacttcaacatggcgatcgagaccgccgtg
aagtgggtcgaggccaactcgaactgggacgaaacgctgatcatcgtgaccaccgaccac
ggtaacggcctgctggccggcccgcagtccgacacgatcgcctaccagccgatcgtcaac
cagggccaaggcgcgatgccgctggtgcgctggcacagcgacacccacacccgcgagctg
gttccgctgttcgcccacggcgcaggttcggaatacttccgcaccaacgccgcagccgaa
gccggccttgcccgctacggcgtcgacgaagccgcccagatctgggtcgacaacaccgac
atcttccatggcgcaatggcagccatgggcatcgaagaagtcgctgcaaactaa

DBGET integrated database retrieval system