KEGG   Kocuria rosea: EQG70_10430Help
Entry
EQG70_10430       CDS       T06074                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
krs  Kocuria rosea
Pathway
krs00030  Pentose phosphate pathway
krs00480  Glutathione metabolism
krs01100  Metabolic pathways
krs01110  Biosynthesis of secondary metabolites
krs01120  Microbial metabolism in diverse environments
krs01130  Biosynthesis of antibiotics
krs01200  Carbon metabolism
Module
krs_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
krs_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:krs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EQG70_10430
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EQG70_10430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:krs04147]
    EQG70_10430
Enzymes [BR:krs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EQG70_10430
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EQG70_10430
Exosome [BR:krs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EQG70_10430
  Exosomal proteins of colorectal cancer cells
   EQG70_10430
  Exosomal proteins of bladder cancer cells
   EQG70_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: QCY34747
Position
2239334..2240845
Genome map
AA seq 503 aa AA seqDB search
MRDPRDRRLVRVAAPSALVLFGVTGDLAKKKLLPAMYDLVNRGLLPPSFALVGFGRRDWS
HEQFREVVRESVEAHARTPFQEDVWRQFASGVRFVRGEFDEDKAYEALKSTLKELDVHSG
TRGNHAFYLSIPPKAFETVCQQLADHGLAQHENASGWRRVVIEKPFGHDLESAQELNAIV
ERVFPADSVFRIDHYLGKETVQNILALRFANQMFEPLWNAQFVDHVQITMAEDIGIGSRA
GYYDGVGAARDVIQNHLLQLLALTAMEEPLSFQAHHMRAEKAKVLASVVVPEDRAAHSAL
GQYEAGLQGGERVRGFLEEQDIPADSRTETYAALRVDINNRRWAGVPFYLRAGKRLGRRV
TEIAVQFKNSPNLLFGDNGHEDLGQNVIVVRIQPDEGVTIRLGSKVPGTQSEIRDVTMDF
GYGHSFTESSPEAYERLILDLLLGEPPLFPDHEEVELSWRILDPFEQCWSEQEIMPEPYA
PGSWGPAAADELLARDGRVWRRP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggacccgagggacaggcggctcgtccgggtcgccgccccgtcggcgctcgtgctc
ttcggcgtgacgggagacctcgcgaagaagaagctgctgccggcgatgtacgacctcgtc
aaccggggtctgctgccgccgtccttcgcgctcgtcggcttcggccgccgcgactggtcc
cacgagcagttccgcgaggtggtgcgcgagtccgtcgaggcgcacgcccgcacccccttc
caggaggacgtgtggcgccagttcgcctccggcgtccggttcgtgcgcggggagttcgac
gaggacaaggcctacgaggcgctcaagtcgaccctcaaggagctcgacgtgcactcgggg
acgcgcggcaaccacgcgttctacctctcgatcccgccgaaggcgttcgagacggtctgc
cagcagctcgccgaccacggcctggcccagcacgagaacgcctccgggtggcgccgcgtg
gtcatcgagaagcccttcggccacgacctcgagtccgcgcaggagctcaacgccatcgtg
gagcgggtgttcccggcggactcggtgttccgcatcgaccactacctgggcaaggagacg
gtgcagaacatcctggcgctgcgcttcgcgaaccagatgttcgagcccctgtggaacgcg
cagttcgtggaccacgtgcagatcaccatggccgaggacatcggcatcggctcccgcgcc
ggctactacgacggcgtgggcgcggcccgcgacgtcatccagaaccacctgctgcagctg
ctggccctcacggccatggaggagccgctgtccttccaggcccaccacatgcgcgccgag
aaggcgaaggtcctggcctccgtcgtcgtccccgaggaccgggcggcgcactcggcgctc
ggccagtacgaggccggtctgcagggcggtgagcgcgtgcggggcttcctcgaggagcag
gacatccccgccgactcccgcaccgagacctacgcggcgctgcgcgtggacatcaacaac
cgccggtgggcgggcgtgccgttctacctgcgcgccggcaagcgcctgggccggcgggtg
accgagatcgcggtgcagttcaagaactcccccaacctgctgttcggggacaacggccac
gaggacctgggacagaacgtcatcgtggtccggatccagcccgacgagggcgtgaccatc
cggctgggctccaaggtgcccgggacccagtcggagatccgggacgtcacgatggacttc
ggctacggccactcgttcaccgagtccagcccggaggcctacgagcgcctgatcctcgac
ctgctgctcggggaaccaccactgttccccgaccacgaggaggtcgagctgtcctggcgg
atcctcgaccccttcgagcagtgctggtcggagcaggagatcatgccggagccctacgcg
cccgggtcctggggacccgccgccgccgacgagctgctggcccgcgacggacgcgtctgg
aggcgaccgtga

DBGET integrated database retrieval system