KEGG   Kosakonia sacchari: C813_00835Help
Entry
C813_00835        CDS       T03601                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
ksa  Kosakonia sacchari
Pathway
ksa02020  Two-component system
ksa02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C813_00835
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    C813_00835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ksa01001]
    C813_00835
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ksa02022]
    C813_00835
   02035 Bacterial motility proteins [BR:ksa02035]
    C813_00835
Enzymes [BR:ksa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     C813_00835
Protein kinases [BR:ksa01001]
 Histidine kinases
  CheA family [OT]
   C813_00835
Two-component system [BR:ksa02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   C813_00835
Bacterial motility proteins [BR:ksa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    C813_00835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding Hpt H-kinase_dim HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AHJ73474
Position
1920332..1922383
Genome map
AA seq 683 aa AA seqDB search
MSMDISDFYQTFFDEADELLADMEQHLLDLVPEAPDSEQLNAIFRAAHSIKGGAGTFGFT
ILQETTHLMENLLDEARRGEMQLNTDIINLFLETKDIMQEQLDAYKSSSEPDAASFEYIC
NALRQLALEAKGEVVPAAANGAKLSVVETALASEATAPAAENDGKLRIVLSRLKESEVDL
LEEELGNLGTLSDVVKGKNNLSVTIDGGVSEDDIIAVLCFVIEADQIAFEKAAPAPAAAE
TAVEAPAEVAEAPAAAAVPAVQAAPAPALKAVAKEQPAGREKPAARASESTSIRVAVEKV
DQLINLVGELVITQSMLAQRSNELDPVTHGDLITSMSQLQRNARDLQESVMSIRMMPMEY
VFSRFPRLVRDLASKLDKQVELTLQGSSTELDKSLIERIIDPLTHLVRNSLDHGIETPEK
RVEAGKSPIGNLILSAEHQGGNICIEVTDDGAGLNRERILAKAISQGMAVNENMTDEEVG
MLIFAPGFSTAEQVTDVSGRGVGMDVVKRNIQEMGGHVEIKSKQGTGTTIRILLPLTLAI
LDGMSVKVNNEVFILPLNAVMESLQPREEDLHPLAGGERVLEVRGEYLPLVELWKVFDVM
GAKTEATQGIVVILQSAGRRYALLVDQLIGQHQVVVKNLESNYRKVPGISAATILGDGSV
ALIVDVSALQGLNREHRMAHTAA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatggatattagtgatttttaccaaacattctttgatgaggccgacgaactgttg
gccgatatggaacaacatttattggatctggtgccggaagcgccggattcagaacagctc
aacgccatcttccgtgctgctcactctattaaaggcggtgcgggtacatttggctttacc
atcttgcaggaaacaacccacctgatggagaacctgcttgatgaggctcggcgtggcgag
atgcagctcaacaccgacattatcaacctgtttttggaaaccaaagatattatgcaggaa
cagctcgatgcctataaaagctcgtcagagccagatgccgcaagcttcgaatacatctgc
aatgccctgcgccagctggcgctggaggcaaaaggagaggtcgttcctgccgctgcgaat
ggggcaaaactctctgttgtagagaccgcactggcatctgaagcgaccgcgcccgccgct
gaaaacgacggcaaactgcgaattgtcctttctcgcctgaaagagagtgaagttgactta
ctcgaagaagagctgggcaacctcggcacgctgagcgatgtcgtgaaggggaaaaataac
ctgagcgtgacgatcgacggtggcgtgagcgaagacgacattatcgcggtgctgtgtttt
gttatcgaagcggaccaaattgctttcgaaaaagcggcacccgcgcccgcggcagcagaa
actgctgttgaagccccggcggaagtggctgaagcgccggcagcagcggctgtcccggcg
gtgcaggcggctcctgcacctgcactgaaagcggtagcgaaagagcaaccggctggccgt
gaaaaaccggcagcccgcgccagtgaatcgaccagtatccgtgttgcggttgaaaaagtt
gaccagttgatcaacctggttggcgaactggttatcacccagtccatgctggcgcagcgc
tctaacgagctggatccggtaacgcacggtgatttaataaccagcatgagccaactgcaa
cgcaacgcccgcgacctgcaggaatcggtgatgtccatccgtatgatgccgatggaatat
gtcttcagccgcttcccgcgcctggttcgcgatctggcgagcaagcttgataaacaagta
gagctgacgctgcagggcagctcaaccgaacttgataagagcttgatcgaacgcattatt
gacccgttaacgcacctggtgcgtaacagcctcgaccacggtatcgaaacgccggaaaaa
cgtgtggaagcagggaagtcgcctatcggcaacctgatcctctcggcggaacaccagggc
gggaacatctgtattgaagtgaccgacgatggtgccggcctgaaccgtgaacgtatcctg
gcgaaagcgatttcgcaggggatggccgtgaacgagaacatgaccgacgaagaagtaggc
atgctgattttcgcgccgggcttctccaccgctgagcaggtaactgatgtttccggacgc
ggcgtggggatggacgtggtgaaacgtaacatccaggagatgggcggtcacgttgaaatc
aaatctaagcagggcactggcacaaccattcgtatcctgctgccgctgacgctggcgatc
ctcgacggcatgtcagtaaaagtgaacaacgaagtctttatcctgccgttaaacgcggta
atggaatcgctgcaaccgcgtgaagaagatctgcatccgctggccggtggtgagcgcgtg
ctggaagtgcgcggtgaatacctgccgctggttgaactgtggaaagtctttgacgttatg
ggcgcgaaaaccgaggccacgcaggggattgtcgttattctgcaaagcgcgggtcgtcgc
tatgcattgctggttgatcaactgattggtcagcatcaagtggtggtgaaaaacctggaa
agcaactatcgcaaagtgccgggtatttccgctgccactatccttggggatggtagcgtt
gcgctgatcgttgacgtatcagcgttgcagggattgaatcgtgaacatcgtatggcgcac
acagccgcctga

DBGET integrated database retrieval system