KEGG   Kosakonia sacchari: C813_08435Help
Entry
C813_08435        CDS       T03601                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00860  Porphyrin and chlorophyll metabolism
ksa01100  Metabolic pathways
Module
ksa_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C813_08435
Enzymes [BR:ksa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C813_08435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHJ74759
Position
3453219..3453836
Genome map
AA seq 205 aa AA seqDB search
MRLWLIRHGETEANVAGLYSGHSPTPLTPRGLAQAKTLRELLAHVPFDYVLCSELERAQQ
TAARVLESRALAVHTTPLLNEMFFGDWEMRHHRDLTREDPQSYAAWCTDWQHAVPTNGEG
FQAFSARIEQVIALVADIKSQHKNVLIASHQGVLSLLIARLLGMPAASLWHFRVDQGCWS
AIDIHDDFATLRVLNSRAAWHADDV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctggctgatacgccacggagaaaccgaagcgaatgttgccgggctttatagc
ggccactcaccgactccactgacacccagagggctagcgcaggcgaaaaccctgcgtgag
ttactcgcgcatgtgcccttcgattatgtgctttgtagcgaactggagcgcgcgcagcag
acggccgcgcgcgtactggaatcgcgcgcgcttgctgttcataccacaccgttactcaat
gagatgtttttcggcgactgggaaatgcgccatcatcgcgatttaacgcgagaagatccg
caaagctatgccgcctggtgtaccgactggcagcacgccgttcccaccaatggtgaagga
tttcaggccttttctgcacgaattgagcaagttattgcgctcgttgccgatataaaaagt
cagcacaagaatgtgttgattgccagccatcagggagtgttgagtttgttgatcgcccgc
ttactcggcatgcctgctgcatcgctgtggcattttcgtgttgatcaagggtgctggagc
gctattgatatccatgatgatttcgccacgctgcgggtattaaatagccgggcagcatgg
cacgctgacgatgtatag

DBGET integrated database retrieval system