KEGG   Kosakonia sacchari: C813_11485Help
Entry
C813_11485        CDS       T03601                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ksa  Kosakonia sacchari
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C813_11485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AHJ75284
Position
4088137..4088514
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSIYIESQSAPDDERYVFAYTITIRNLGRTPVQLLKRYWLITNGNGRAT
EVQGEGVVGVQPHIEPGGEYQYTSGAVIETPLGTMQGHYEMIDAQGETFRIAIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtttgtgttcaggtacaaagcatctacatcgagtctcagtcc
gctcccgacgatgaacgctatgttttcgcttacaccattaccatccggaacctggggcga
acccctgtccagctgctcaaacgctactggctgatcaccaatggaaatggccgcgcaacg
gaagttcagggcgaaggtgtggttggcgtacagccgcacattgagccaggcggcgaatat
caatataccagcggcgcggtgattgaaacgccgctgggcaccatgcaaggccactacgaa
atgatcgatgcgcagggagaaaccttccgcatcgctatcccggtcttccgactcgccgtt
ccaacactgatccattaa

DBGET integrated database retrieval system