KEGG   Kosakonia sacchari: C813_14020Help
Entry
C813_14020        CDS       T03601                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00620  Pyruvate metabolism
ksa00630  Glyoxylate and dicarboxylate metabolism
ksa01100  Metabolic pathways
ksa01110  Biosynthesis of secondary metabolites
ksa01120  Microbial metabolism in diverse environments
ksa01200  Carbon metabolism
Module
ksa_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C813_14020
   00630 Glyoxylate and dicarboxylate metabolism
    C813_14020
Enzymes [BR:ksa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     C813_14020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AHJ75720
Position
complement(4598342..4599943)
Genome map
AA seq 533 aa AA seqDB search
MTQQATTTDELAFTRPHGEQEKQILTPAAVEFLSELVTRFTPKRNQLLAARVHQQQQIDA
GTLPDFISETASIRESNWTIRGIPDDLLDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPNWDKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLVCRVRGLHLPEKHVTWR
EEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQSWQEAAWWSEVFSFTEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTMKNYPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKDTERNNWVLNKVKADKQLEANNG
HDGTWIAHPGLGDTVMEVFNAALGEHKNQLFVSREDDAPITAEALLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
QMLAEEMLVIQEELGEHRFSSGRFNDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggcaacaacaaccgatgaattagcctttacgcgaccgcacggtgaacaa
gagaagcagattctcactccggcagccgtggaattcctgagcgagctggtcacccgcttt
acgccaaagcgcaatcaactgctggccgcgcgtgtgcatcagcagcaacagatcgatgcc
ggtacgttgcctgattttatttcggaaacagcttccattcgtgaaagtaactggacgatc
cggggaattcccgacgatctgctggaccgccgcgttgagatcaccgggccggttgagcgc
aaaatggtaatcaacgcgctgaatgccaacgtgaaggtgttcatggcggattttgaagat
tcgctggctccaaactgggacaaagtgatcgacgggcagatcaaccttcgcgatgcagtc
aacggcaccatcagctacaccaatgaagcgggtaaaatctaccaactgaagccaaacccg
gcggtgctggtttgccgtgtgcgtggtttacacctgccggaaaaacacgtcacctggcgc
gaagaggctattccgggcagcctcttcgatttcgcgctctactttttccataaccacaaa
aatctgctcgccaaaggcagcggcccctatttctacctgccgaaaacacagtcatggcaa
gaagcggcatggtggagcgaggttttcagctttaccgaggatcgtttcaatctgccgcgc
ggcaccatcaaagccacgctgctgattgaaaccttacctgcggtattccagatggatgag
atcctgcatgcgctgcgcgaccacattgttggcttgaactgcggacgctgggattacatc
ttcagctacatcaagacgatgaaaaactatccggatcgcgtgctgcctgaccgccaggtg
gtgacgatggataaaccgttcctcagtgcttattcacgtctgctgatcaaaacttgccat
cgtcgcggcgctttcgcgatgggcggtatggcggcgtttatccccagcaaagacaccgag
cgtaacaactgggtgctgaacaaagtgaaagccgataaacagctcgaagcgaataacggt
catgatggcacctggattgcgcatccggggcttggtgacacggtgatggaggtgtttaac
gcggcgctgggcgaacacaaaaatcaactctttgtcagccgtgaggacgatgcgccgatc
accgcagaagctctgctggcgccttgtgaaggtgagcgcaccgaagagggcatgcgcgcc
aatatccgcgttgcggtgcagtacatcgaagcgtggatctccggcaatggctgcgtgccg
atttacgggctgatggaagatgccgccacggcggaaatttcccgtacctcaatctggcaa
tggatccatcacgaaaaaacgctgagcaacggcaagccggtcactaaagcgctgttccgc
cagatgctggctgaagagatgctggttattcaggaagagttgggcgagcaccgtttcagc
agcgggcgttttaacgatgccgcgcgcctgatggagcagatcaccacttctgatgagttg
atcgacttcttgacgttacctggctaccgcctgctggcgtaa

DBGET integrated database retrieval system