KEGG   Kosakonia sacchari: C813_16235Help
Entry
C813_16235        CDS       T03601                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00051  Fructose and mannose metabolism
ksa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C813_16235
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C813_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHJ76081
Position
complement(136080..137243)
Genome map
AA seq 387 aa AA seqDB search
MKVKTMKALHFGAGNIGRGFIGKLLADAGIELTFADVNQVVLDALNARHSYQVHVVGEKE
QVDTVSGVNAVSSIGDEVIDLIASVDLVTTAVGPVVLERIAPAIAKGLAKRKAQGINTPL
NIIACENMVRGTTQLKGHVIAALADADKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVT
VETFSEWIVDKTQFKGTLPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKQTGHQTI
RDAILDASIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYNLPHANLVKGIAAAMHYRSEQDPQAQELAQLIEEKGPQ
AALAQVSGLDANSPVVNEAVSAYNARA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaagactatgaaagcattgcattttggcgcaggtaatatcggacgtggcttt
atcggcaagttgctcgccgacgcggggattgaactgacgttcgccgatgtgaatcaggtg
gtgctcgacgcccttaatgcccgtcatagctatcaggtgcatgtggttggtgaaaaagag
caggtcgataccgtctccggcgttaacgccgtgagcagcattggcgacgaggttatcgac
ctgattgcgagcgttgatctggtgaccacggcggtcggtccggtggtgctggaacgcatc
gccccggctatcgccaaaggtctggcaaaacgtaaagcacagggcattaacacgccgctg
aacattatcgcttgtgaaaatatggtgcgcggcaccacgcagttaaaaggccatgttatt
gccgcgttagcggacgccgacaaagcctgggttgaagagcatgttggcttcgtggattcc
gccgttgaccgtattgttccgccgtctgcatccgctaccaacgatccgctggaagtgacg
gtggaaaccttcagcgagtggattgtcgacaaaacccagttcaaaggcacgctgccgaac
attccgggcatggaattaactgataacctgatggcatttgttgaacgtaagctcttcacg
ctgaataccgggcatgctataaccgcgtaccttggaaaacagaccggccatcaaaccatt
cgcgacgccattctggatgccagcatccgtgcggttgtgaaaggcgcaatggaagagagt
ggcgcggtgctgatcaaacgttatggcttcgatgccgacaagcatgctgcgtatattcag
aaaatcctgggccgttttgaaaacccttatctgaaagacgatgttgagcgcgtaggtcgt
caaccgctgcgtaaactgagcgcgggcgatcgcctgatcaaaccgctgctcggcacgctg
gagtacaacctgccgcacgcgaacctggtgaaaggcattgccgctgctatgcattaccgc
agcgagcaggatccgcaggcgcaggagctggctcagcttatcgaagagaaaggcccgcaa
gccgcgctggcgcaggtttcaggcctggatgctaacagcccggtcgttaacgaagccgtc
agcgcctataacgccagggcatga

DBGET integrated database retrieval system