KEGG   Kosakonia sacchari: C813_19470Help
Entry
C813_19470        CDS       T03601                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00270  Cysteine and methionine metabolism
ksa00480  Glutathione metabolism
ksa01100  Metabolic pathways
Module
ksa_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C813_19470
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C813_19470
Enzymes [BR:ksa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     C813_19470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AHJ76641
Position
complement(796181..797128)
Genome map
AA seq 315 aa AA seqDB search
MIKLGIVMDPIADINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE
HNYDKWYEFGSEQDMALAELDTILMRKDPPFDTEYIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFPELTPETLVTRNKAQLKAFWQKHTDVILKPLDGMGGTSIFRVKEGDPNL
SVIAETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLSESDWAIARKVAPVLKAKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPIS
ITGMLMDAIEKRLGK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggcatcgtgatggatcccatcgcggacatcaatatcaaaaaagactcc
agcttcgccatgctgctggaagctcagcgccgcggctacgagctgcactatatggagatg
gcggatctttatctgattaacggtgaagctcgcgcccgaactcgtacgttgtccgtcgaa
cacaattacgacaaatggtatgaattcggcagcgaacaggatatggctctcgccgagctg
gacactatcctgatgcgtaaagatccgccgttcgataccgaatatatttatgcgacgtat
atccttgaacgcgcggaagaaaaaggcacgctgatcgtgaacaaaccgcaaagcctgcgt
gactgtaacgaaaagctgttcaccgcctggttcccggaattaactccggaaacgctggtc
acccgcaacaaagcacaactgaaagccttctggcaaaagcacacagacgtcattcttaag
ccgctggacggcatgggcggcacctcaattttccgcgtgaaagagggcgatccaaacctc
tcggttatcgccgaaacgctgaccgagctgggtagccgctactgcatggcgcagaactac
ctgcccgccatcaaagatggcgacaaacgcgtgctggtcgttgatggcgaaccggtgcct
tactgtctggcgcgcattccgcagggcggtgaaactcgcggtaacctcgccgcaggtgga
cgcggcgaaccacgcccgttaagcgaaagcgactgggctatcgcgcgtaaagtcgcgccg
gtgctgaaagcgaaagggttaatctttgtcggcctggatattatcggcgatcgcctgacc
gaaattaacgtcaccagcccgacgtgcatccgcgaaatcgaagcggaattcccgatctcc
attaccggtatgttgatggacgctatcgaaaaacgcctcggaaaataa

DBGET integrated database retrieval system