KEGG   Kosakonia sacchari: C813_19850Help
Entry
C813_19850        CDS       T03601                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00071  Fatty acid degradation
ksa00280  Valine, leucine and isoleucine degradation
ksa00310  Lysine degradation
ksa00362  Benzoate degradation
ksa00380  Tryptophan metabolism
ksa00620  Pyruvate metabolism
ksa00630  Glyoxylate and dicarboxylate metabolism
ksa00640  Propanoate metabolism
ksa00650  Butanoate metabolism
ksa00900  Terpenoid backbone biosynthesis
ksa01100  Metabolic pathways
ksa01110  Biosynthesis of secondary metabolites
ksa01120  Microbial metabolism in diverse environments
ksa01130  Biosynthesis of antibiotics
ksa01200  Carbon metabolism
ksa01212  Fatty acid metabolism
ksa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C813_19850
   00630 Glyoxylate and dicarboxylate metabolism
    C813_19850
   00640 Propanoate metabolism
    C813_19850
   00650 Butanoate metabolism
    C813_19850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C813_19850
   00072 Synthesis and degradation of ketone bodies
    C813_19850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C813_19850
   00310 Lysine degradation
    C813_19850
   00380 Tryptophan metabolism
    C813_19850
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C813_19850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C813_19850
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C813_19850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ksa04147]
    C813_19850
Enzymes [BR:ksa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C813_19850
Exosome [BR:ksa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C813_19850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHJ76712
UniProt: W6J6F0
Position
872260..873441
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGAVRTPIGCFQGALSRLSAVELGSQVVRALIERSGVQPQDIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLASQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRERQDEWAL
SSQHKARVAIDSGRFRDEIVPVSAMDAAGQTQVIDTDEQPRTDPSAEALAKLAPAFEQSG
SVTAGNASPINDGAAAVLVMSEAKAQELNLPVLARIRAFASVGVDPALMGIAPVYAMRRC
LERAGWQLDDVDLIEANEAYAAQALSVGKILEWDEKRVNVNGGAIALGHPIGASGCRILV
SLVHEMQKRQARKGLATLCIGGGQGVALAIERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtgatagtcggcgcggttcgcacgcctatcggctgttttcagggcgca
ttgtcacgcctctctgccgttgagttgggcagccaggtggtgcgtgcgttgattgaacgt
agcggcgtgcagccacaagatatcgacgaagtgattttaggccaggtgctgacagcaggt
gccgggcaaaaccctgcgcggcagtcggcgatcaaaggcggcctgccgaatacggtttca
gcaatcaccattaatgatgtctgcggctccgggctgaaagccctgcacctggcttcgcag
gcgattcagtgtggcgaagctgatgtggtgattgctggcgggcaggagaatatgagccgt
gcgccgcatgtgctgaccgacagccgcaccggtgcacagctcggcaacagccagcttatt
gatagcctggtgcatgacggtttgtgggacgccttcaacgattaccatatgggcgtaacg
gcggaaaacctggcgcgtgaatatggcatcagccgcgagcgtcaggatgaatgggcgtta
agctcgcagcacaaagcgcgtgtcgctatcgattccgggcgttttcgcgatgaaattgtt
ccggtaagcgcgatggatgcagcaggtcagacgcaggttattgataccgatgaacaaccg
cgcactgaccccagcgcggaagcgctggcaaaactcgcgcccgcgtttgaacaaagcggc
tcggttactgccggtaacgcctcacccatcaatgacggtgcggcggcggtgctggtaatg
agcgaagcaaaagcgcaggaactgaatttaccggtgctggcgcgcatccgcgcatttgcc
agcgttggtgtcgacccggcgttaatgggtattgcgccggtttatgccatgcgccgctgc
cttgagcgcgcaggctggcaacttgatgatgtcgatctgattgaagcgaacgaagcttat
gcagcgcaggcgttgtcagtcggtaaaatcctcgagtgggatgagaaacgcgtgaatgtc
aacggtggggcgatagcgctgggccacccgattggcgcttccggctgccgtattctggtt
tcgctggtgcatgaaatgcaaaaaaggcaggcccgtaaagggctggcaaccttatgcatc
ggcggtggccagggtgtggcgttagcaatcgaacgcgattaa

DBGET integrated database retrieval system