KEGG   Komagataeibacter saccharivorans: CD178_00196Help
Entry
CD178_00196       CDS       T05634                                 

Gene name
mutM
Definition
(GenBank) Formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CD178_00196 (mutM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ksc03400]
    CD178_00196 (mutM)
Enzymes [BR:ksc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CD178_00196 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CD178_00196 (mutM)
DNA repair and recombination proteins [BR:ksc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CD178_00196 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: AXY21026
UniProt: A0A347W833
Position
complement(199399..200280)
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVMRGMRVHLEGHTISHASTHHTGLRWPFPPGLAKALSGRRVDGFARRGKYI
LITLSGGMVALLHLGMSGRIVLSRPDADEPVAPPARHEHLVIETREGARCGLVDPRRFGM
VDLVAADKVETHRLLAGMGPEPLGNRFDGAWLAQKGRGRRSSIKALLLDQRVVAGLGNIY
VSEALFRARIHPARAAGDVSEAEYATLVTQIRIVLEEAIAAGGSSLRDYVQPDGELGYFQ
HAWRVYGREGTGCPECPGPPGCDGVVRITQSGRSTFFCPRLQADENDFGKDLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccctgaagtcgaaactgtgatgcgcgggatgcgagtgcatcttgaaggt
cacacaatttcccacgccagcacgcaccataccggcctgcgatggccatttccgcccggc
ctggccaaagcactgtcggggcggcgggtggatggattcgcccggcgtggcaaatatatt
ctcataacgttgtcgggcggcatggttgcgctgctgcatctgggcatgtcggggcgcatc
gtgctgtcgcgcccggatgcggatgaacccgtggccccgcccgcccggcatgaacatctg
gttatcgaaacacgcgagggcgcgcgttgcgggcttgtcgatccgcgccggttcggcatg
gtcgatctggtcgcggcggacaaggtggaaacccatcgtctgctggctggcatggggccg
gaaccgctgggcaaccgctttgatggcgcatggctggcgcagaagggcagggggcggcgc
agcagcatcaaggccctgctgctggatcagcgcgtcgtggcggggttgggtaatatatat
gtatccgaagccctgttccgggcgcgcatccatcccgcacgcgcggcaggggatgtaagt
gaggcggaatatgccaccctcgtcacccagatccgcatcgtgctggaagaagcgatcgcc
gctggcgggtcaagcctgcgtgattatgtgcaaccggacggggaactgggttattttcag
catgcctggcgcgtctatgggcgtgaggggacgggatgcccggagtgtcccggtccgccg
gggtgtgacggtgtggtgcggatcacccagtccgggcggtccaccttcttctgtccgcgc
ctgcaggctgatgaaaacgattttggtaaagacttgtcttga

DBGET integrated database retrieval system