KEGG   Komagataeibacter saccharivorans: CD178_00376Help
Entry
CD178_00376       CDS       T05634                                 

Gene name
ywrD
Definition
(GenBank) Putative gamma-glutamyltransferase YwrD
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc00230  Purine metabolism
ksc01100  Metabolic pathways
ksc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CD178_00376 (ywrD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ksc01002]
    CD178_00376 (ywrD)
Enzymes [BR:ksc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     CD178_00376 (ywrD)
Peptidases and inhibitors [BR:ksc01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CD178_00376 (ywrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AXY21195
UniProt: A0A347W8K2
Position
complement(400238..401830)
Genome map
AA seq 530 aa AA seqDB search
MLNTPRSCRGMVTSPHHLASQAGLDVLKAGGTALEAAVATAAALAVVYPHMTGIGGDAFW
LTMWPDGRVETIDACGAAAQRADAGFYQSAGLDAIPWRGPLAANTVAGTVSGWDMALAWS
HEVAPGLPLGRVLRDAIYYAEQGVPVTASAADITREKAGELKDVPGFRDLFMPGGRLPQV
GDILHNPRLAGTLRQLADEGLSSFYHGTVARELAADLRDLGSPLALADLQAHKASHQPAL
HARIHGADLFNMAPPTQGVASLLILALFDRLKAAKADDFDYLHGLVEATKQAFRYRDTHV
GDPAYMTVQAQDILDDRKALDRMAHAIDPAHAAPWPWPSQAGDTVWLGVIDSDGLAVSMI
QSLYFEYGSGIVLPRTGVVWQNRGTSFGLDPEGWNGLRPGRKPFHTLNPAGARFDDGRTM
VYGTMGGEGQPQTQAAIFSRYARYGVPLQAAVTAPRWLLGRTWGETSVSLKYEDRFDPAV
IARMQAAGHQMERVEPFSSRMGHAGALVRHASGLLEGATDPRSDGCVAAW
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatacgccgcgttcatgccgggggatggtgacatccccgcaccatctggccagt
caggccgggctggatgtgctcaaggccggtggtaccgcgctggaagccgccgttgcgacg
gcggcggcgctggctgtcgtctatccgcatatgaccgggatcggcggcgatgcgttctgg
ctgaccatgtggcccgatgggcgggtggaaaccatcgatgcctgcggcgctgcggcgcag
cgggccgatgccggtttttaccagtccgccggacttgatgcgattccctggcgtggaccg
cttgcggccaatacggtcgcgggcacggtatcgggatgggatatggcgctggcgtggagc
catgaagtggcccccggcctgccgctgggccgcgtgctgcgcgatgcgatatactatgct
gaacagggcgtgcccgttaccgccagcgctgcggacatcacgcgtgaaaaggccggtgaa
ctgaaggatgtgcccggttttcgggacctgttcatgcccggtggccgcctgccgcaggta
ggtgacatcctgcacaatccccgcctggccgggacattgcggcaactggctgatgaagga
ctgtccagcttctaccatggtacggttgcgcgtgaactggccgccgacctgcgcgatctg
ggcagcccgcttgcgctggccgacctgcaggcgcacaaggccagccaccagccagcgctc
catgcccgtatccacggggccgacctgttcaacatggccccgcccacgcagggcgtcgca
tcgctgctgatccttgcgctgtttgaccggctcaaggccgcgaaggcggatgatttcgat
tacctgcatggtctggtcgaagccaccaagcaggcgttccgctaccgtgatacgcatgtg
ggtgatcccgcctacatgacggtgcaggcgcaggacattcttgatgaccgcaaggcgctt
gaccgcatggcgcatgccattgatccggcgcatgcggccccgtggccgtggccatcgcag
gcaggcgatacggtgtggctgggtgtgatcgattccgacggtctggccgtcagcatgatc
cagagcctgtatttcgaatatggttcgggcatcgtgctgccgcgcaccggcgttgtctgg
cagaaccgtggcaccagctttggccttgatcccgaagggtggaatggcctgcgccccggt
cgcaagccgtttcataccctcaaccccgcaggcgcgcgtttcgatgacggacgcaccatg
gtgtacggcaccatgggcggggaaggacagccacagacgcaggccgccatcttcagccgt
tacgcgcggtatggcgtgccgttgcaggcggctgttaccgccccgcgctggctgctgggc
cgtacgtggggcgagacgagcgtcagcctgaaatatgaagaccgcttcgatccggcggtc
atcgcgcgcatgcaggcggcgggccaccagatggaacgcgtcgagccgttttcatccagg
atgggacatgcgggcgcgcttgtgcgtcatgcgtccggcctgctggaaggggcaaccgat
ccccgcagcgatggatgcgtggcggcatggtag

DBGET integrated database retrieval system