KEGG   Komagataeibacter saccharivorans: CD178_01513Help
Entry
CD178_01513       CDS       T05634                                 

Gene name
betB_2
Definition
(GenBank) NAD/NADP-dependent betaine aldehyde dehydrogenase
  KO
K23463  (Z)-2-((N-methylformamido)methylene)-5-hydroxybutyrolactone dehydrogenase [EC:1.2.1.-]
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD178_01513 (betB_2)
Enzymes [BR:ksc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CD178_01513 (betB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXY22290
UniProt: A0A347WBP7
Position
complement(1595993..1597462)
Genome map
AA seq 489 aa AA seqDB search
MQTFQHYIDGRFEDASATFDSINPATRQPWARMPRAREADVDRAVRAADRAFRAPQWSGL
TASQRGRLLFRLADLIEAEAPHLAELETRDTGKIIRETRAQIAYVAEYYRYYGGLADKVE
GRYIDIDKADTEAYLRREPIGVVAAVVPWNSQLFLSAVKIAPALAAGCTVVLKASEDGPA
PLLAFARLVDKAGFPPGVISILTGFGDDCGRVLTSHPLVSRIAFTGGPETARHVVRNSAE
NLAYLTLELGGKSPVVVFPDADLDSTVNAIISGIFAASGQSCVAGSRLIAHRAILPALLA
RLKERAERIHIGTPDDMATEMGPLATERQVTHIQDLITRSVAAGARLVTGGAPPGHHGEG
YYFRPTILLCENGDTPCLREEFFGPVLSVIAFDDEADAVAQANDTPYGLACGVFTRDLAR
AKRMTAALRAGIVWVNTYRMVSPMMPFGGYGLSGLGREGGMEAMLDYTRTKSVWIRTSDT
PISDPFVMR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgcagactttccagcattatatcgacggccgttttgaagatgcgtcagccacgttcgac
agcatcaaccccgcgacccgccagccatgggcgcgcatgccgcgtgcgcgtgaagcggat
gtggaccgtgcggtccgcgcggccgaccgggcctttcgcgcgccgcagtggtctggcctg
accgccagccagcgtggcaggctgctgttccgccttgcggacctgatcgaagccgaagca
ccacatctggcggaactggaaacgcgcgacaccggcaagatcatccgtgaaacgcgcgcg
cagattgcctatgtggcggagtattaccgttattacggcggtctggccgacaaggtcgaa
gggcgttacatcgatatcgacaaggcggatacggaagcctatctgcgccgcgagcccatc
ggggtcgtcgccgccgtcgtgccatggaattcgcagcttttcctttcggcggtaaagatc
gccccggcgctggcggcgggctgcacggtcgtgctcaaggcatcggaagatggtccggcc
ccgcttctggcctttgcccggctggtggacaaagcgggctttccccccggcgtgatttcg
atcctgaccggctttggcgatgattgcgggcgcgtgctgaccagccacccgctggtatca
cgcatcgcctttaccggtggcccggaaacggcgcgccatgtggtgcgcaacagcgccgaa
aaccttgcttacctgacgcttgaactgggtgggaaatcccctgtggtggtctttcccgat
gcggatctggacagcacggtcaatgccatcatatcgggcatttttgccgccagtggccag
agctgcgttgccggttcgcgcctgatcgcgcaccgcgccatcctgcctgccctcctggca
cggctgaaggaacgcgccgaacgcatccatatcggcacgcccgatgacatggcgaccgaa
atgggtcccctcgccaccgaacgtcaggtcacccatatccaggacctgatcacgcgcagc
gttgccgcaggcgcccggcttgtaaccggcggcgcaccacccgggcaccatggggaaggc
tattatttccgccccacgatcctgttgtgcgaaaacggcgatacgccgtgcctgcgggaa
gaattctttggccccgtactcagcgtcatcgccttcgatgatgaagcggatgcggtggca
caggccaatgatacgccctacggactggcctgcggtgttttcacccgcgatcttgcccgc
gccaagcgcatgacggcggcgctgcgcgcggggatcgtatgggtcaacacctatcgcatg
gtttcgcccatgatgccctttggcggctacggcctgagcgggctggggcgtgaaggcggg
atggaagccatgctggactatacccgcaccaaatcggtgtggatacgcaccagcgatacc
cccatctccgacccgtttgtaatgaggtga

DBGET integrated database retrieval system