KEGG   Komagataeibacter saccharivorans: CD178_02287Help
Entry
CD178_02287       CDS       T05634                                 

Definition
(GenBank) Farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc00900  Terpenoid backbone biosynthesis
ksc01100  Metabolic pathways
ksc01110  Biosynthesis of secondary metabolites
ksc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD178_02287
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ksc01006]
    CD178_02287
Enzymes [BR:ksc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CD178_02287
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CD178_02287
Prenyltransferases [BR:ksc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CD178_02287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: AXY23038
UniProt: A0A347WDU5
Position
complement(2405458..2406393)
Genome map
AA seq 311 aa AA seqDB search
MNQTTATASQTDGTDRMVRLRASMAARATAIEHMIDRLLPRVEGGEARLIDAMRYATLGG
GKRLRGYLVAEVASLFKVAAEGADRVAASVEMLHAYSLVHDDLPAMDDDDLRRGQPSTHR
KFDEATAILAGDALQTMAFDILANPLTHDSADVRINLVRALADASGAAGMVGGQMIDMEG
EGRALSLEEVARLHALKTGCLIRYSAEAGAILGQASDDVRKRISAYGRDLGAAFQIADDV
LDATASAEELGKTAGKDEAAGKSTYVALLGVDGAAREAKRVAEQAESHIDIFGPEADRLR
DLVRYVVERRN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaacaacagcaaccgcgtcccaaacagacggtacggatcgcatggtccgtctg
cgtgcatccatggccgcgcgcgccacggcgatcgaacatatgatcgaccgtctcctgccg
cgcgtcgaagggggggaagcccgcctgatcgacgccatgcgttatgcgacgcttggcggc
ggcaagcgcctgcgtggctatctggtggcggaagtcgccagcctgttcaaggtcgcagcc
gaaggcgcagaccgtgtcgccgcttcggttgaaatgctgcatgcctattccctggtgcat
gacgacctgcccgccatggacgatgacgacctgcgccgtggccagccctccacccatcgc
aagtttgacgaagccaccgccattctggccggtgacgcgctgcagacgatggcgttcgac
attctggccaacccgctgacgcatgacagcgcagatgtgcgcatcaaccttgtccgcgcg
ctggccgacgcatccggtgccgcaggcatggttggcggccagatgatcgacatggaaggt
gaaggccgtgcgctgtcgctggaggaagtcgcccgcctgcacgcgctcaagaccggctgc
ctgatccgctattcagccgaagccggcgccattctggggcaggccagtgatgacgtgcgc
aagcgcatttccgcctatggccgcgatctgggtgccgcgttccagattgcggacgatgtg
ctggacgccaccgccagcgccgaggaactgggcaagacggccggcaaggacgaagccgcg
ggcaagtccacctatgtcgccctgctgggcgtggatggtgccgcgcgtgaggcgaagcgc
gtggccgaacaggctgaatcacatatcgacatttttggcccggaggctgatcgcctgcgc
gatctggtccgctacgtggtcgagcgcaggaactga

DBGET integrated database retrieval system