KEGG   Komagataeibacter saccharivorans: CD178_03193Help
Entry
CD178_03193       CDS       T05634                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc00860  Porphyrin and chlorophyll metabolism
ksc01100  Metabolic pathways
Module
ksc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CD178_03193 (cobQ)
Enzymes [BR:ksc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CD178_03193 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AXY23937
UniProt: A0A347WGE4
Position
unnamed2:9931..11385
Genome map
AA seq 484 aa AA seqDB search
MTAIMLQGTGSDVGKSVLTAGLCRVFANRGLTVRPFKPQNMSNNAAVTVDGGEIGRAQAL
QAQACRIAPSTLMNPVLLKPESDHTAQVIVRGRAKGHLHASSFIGGRAAFLPEVLTAFRT
LCSQSDLVIVEGAGSPAEINLRQGDIANMGFARAANVPVVMIGDIDRGGVIASLAGTHAV
LDPDDRELIKGFIVNRLRGDASIFQSGYDFIEKFTGWKGLGVLPWIDSIRELPSEDSIPE
DVDCSAASRIEIAVPLMPRIANFDDLDALEGETHVKITRIRPGQPLPASAHVVFLPGSKA
TIADLQFFRRQGWDIDLAGHVRRGGYVFGLCGGYQMLGQTINDPDGIEGNPTTIPGLGLL
DVDTVLTRDKQINQTSGMTLSDSARFSGYEIHCGETVRSHHRVMPLIRCDDRRLDGAISP
DGRIAGCYVHRLFDMTGQRAAWLDRWGARSDGLDYTARVERALETVASTMESSLDIEGLL
AIAR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgatcatgttgcagggcacgggatccgatgtcggaaagtccgttttgacggca
ggtttatgccgggttttcgctaaccgtggcctgacggtccggcctttcaaaccccagaat
atgtcgaacaatgccgccgtgacggtagatggaggtgaaatcggtcgggcgcaggcactt
caggcgcaggcctgccgtattgccccttccacccttatgaatccggtccttctgaaaccg
gaaagtgatcatacagcgcaggttatcgtccgtggacgcgcaaaaggacacctgcacgct
tcgagttttatcggtggccgggccgcattcctgcccgaggttctgaccgccttcaggaca
ttatgtagccaatccgatctcgtgattgtcgagggcgcgggcagcccggcggaaatcaat
ctacgtcagggcgacatcgccaatatgggctttgccagagccgcgaatgttccggtcgtc
atgatcggcgatatagaccggggcggtgttatcgcgtcactcgccggtacccatgctgtt
cttgatccagatgaccgtgagttgatcaagggattcatcgttaatcgcctccggggagac
gccagcattttccaatctgggtatgacttcatagaaaagtttaccggctggaaggggctt
ggcgttcttccttggatagacagtatacgtgaactgccttctgaagacagtattcctgaa
gatgttgactgttccgcggcctcacggatcgagatagccgtcccccttatgccccgcatt
gccaatttcgatgatcttgatgcgctggaaggtgaaacgcatgtaaagatcacacggatc
cggcccgggcagccccttcccgcgtccgcgcatgtcgtgttccttcctggtagcaaagcg
acaatagcagacctgcaatttttcaggcggcagggatgggatattgatctggcgggacac
gtcaggcggggtggatatgtattcggtctctgcggtggctatcagatgctgggacagacc
ataaatgatcccgacggaatagaagggaacccgaccacgataccaggacttggacttctg
gacgttgataccgttctgacccgtgacaagcagatcaaccagacttcaggcatgacgctt
tccgatagcgcgcgattcagtggctacgaaattcattgtggggaaacagttcgatcacat
caccgggtcatgcccctgatcagatgcgacgacagacggttggacggagcaataagcccg
gacggtcgtattgcaggctgctatgtgcaccgtctgtttgacatgactggccaacgcgcg
gcatggctggacagatggggcgcacgctccgatggactggattacacagcgcgggtggaa
cgcgcccttgaaaccgttgcttccaccatggaaagcagtctggatattgaagggttactg
gctattgccagatga

DBGET integrated database retrieval system