KEGG   Kangiella sediminilitoris: KS2013_1292Help
Entry
KS2013_1292       CDS       T04467                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00071  Fatty acid degradation
ksd00072  Synthesis and degradation of ketone bodies
ksd00280  Valine, leucine and isoleucine degradation
ksd00310  Lysine degradation
ksd00362  Benzoate degradation
ksd00380  Tryptophan metabolism
ksd00620  Pyruvate metabolism
ksd00630  Glyoxylate and dicarboxylate metabolism
ksd00640  Propanoate metabolism
ksd00650  Butanoate metabolism
ksd00900  Terpenoid backbone biosynthesis
ksd01100  Metabolic pathways
ksd01110  Biosynthesis of secondary metabolites
ksd01120  Microbial metabolism in diverse environments
ksd01130  Biosynthesis of antibiotics
ksd01200  Carbon metabolism
ksd01212  Fatty acid metabolism
ksd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KS2013_1292
   00630 Glyoxylate and dicarboxylate metabolism
    KS2013_1292
   00640 Propanoate metabolism
    KS2013_1292
   00650 Butanoate metabolism
    KS2013_1292
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KS2013_1292
   00072 Synthesis and degradation of ketone bodies
    KS2013_1292
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KS2013_1292
   00310 Lysine degradation
    KS2013_1292
   00380 Tryptophan metabolism
    KS2013_1292
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KS2013_1292
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KS2013_1292
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KS2013_1292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ksd04147]
    KS2013_1292
Enzymes [BR:ksd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KS2013_1292
Exosome [BR:ksd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KS2013_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOE50006
UniProt: A0A1B3BB56
Position
1419272..1420450
Genome map
AA seq 392 aa AA seqDB search
MSDPIVIVSAARTPMGGFGGSLSTVKSTELGANAIAAAVERATLKPEDIQEVIMGCVLPA
GVGQAPARQASLGAGIPKSTGATTVNKVCGSGMKTIMLAHDLLKAGTNDVMVAGGMESMS
LAPYLLPTGRYGQRFGHGKTLDHMAFDGLEDAYEGQAMGVYAEQTVEKYGFTREDQDNFA
IESLARANKAIEDGSFKNEITPVTVKSRKGDTVVDTDEQPLKARPDKIPALRPAFKKDGT
VTAANASSISDGAAAVVMMRQSEAEKRGLKPLAKIHAHSTNARTPAEFTIAPVGAIEKVL
DSAGWTKDDVDLFEINEAFAVVTMAAMKDLELDHAKVNVHGGACALGHPIGCSGTRIVVT
LLEALRKYGKSKGIASLCIGGGEATALAVELL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacccaatcgtaattgtttcagcagcacgaacccctatgggcggctttggtggc
tcattatcaacagtaaaatcaacggagcttggcgccaatgcaattgcagcagcggttgag
cgagccactttaaaaccagaagacattcaagaagtgatcatgggttgtgtgctaccagca
ggtgttggccaggccccggctcgtcaagcgtctttaggtgctggcataccaaaatcaact
ggcgctactactgttaataaagtatgtggttccggcatgaaaacgatcatgctagctcac
gacctgcttaaagctggtactaatgacgtcatggttgcaggtggtatggaaagcatgagt
ttagcgccgtatctactaccaactggtcgttatggtcaacgtttcggtcatgggaaaaca
ctcgaccatatggcttttgatggtcttgaagatgcttacgaaggtcaggcaatgggtgtt
tacgctgagcagacagtagaaaagtatggtttcacacgtgaagaccaggataactttgct
attgaatcccttgcccgtgccaacaaggcaattgaagatggctcatttaaaaatgaaatc
acacccgtcactgttaaatcacgtaaaggggatacggttgttgatactgatgaacaacca
ctgaaagctcgcccagacaagattccagcattgcgccctgcttttaaaaaggacggtacc
gtaactgctgcaaatgcgagttctatttctgatggagcagcagctgttgttatgatgcgt
caatcagaagccgagaagcgtggtctaaaacctcttgcaaagattcatgcgcattcgaca
aacgccagaactcctgctgagtttacaattgctccagttggcgcaattgaaaaagtattg
gattcagctggatggacaaaagatgacgttgatctgtttgaaatcaatgaagcatttgcc
gtagtgacaatggcagcgatgaaagatcttgagctagaccatgcgaaggtcaatgttcac
ggtggtgcctgtgcgcttggccacccaattggctgctcaggtactcgtattgttgtgaca
ttattggaagcactgcgtaaatacggcaagtctaaaggtattgcatccctttgtatcggt
ggtggtgaagcgacagctttagcagttgaactgctataa

DBGET integrated database retrieval system