KEGG   Kangiella sediminilitoris: KS2013_1504Help
Entry
KS2013_1504       CDS       T04467                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ksd  Kangiella sediminilitoris
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KS2013_1504
Enzymes [BR:ksd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     KS2013_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AOE50216
UniProt: A0A1B3BBP7
Position
complement(1659735..1660580)
Genome map
AA seq 281 aa AA seqDB search
MMLRDLHCHTVASDGDLTVSELLKLASERGVDELAITDHDSIDCLAESMSLAEGFDINLV
PGVEISATAGRKKDTLHIVGLQVDYQHAGLTSFLRDIQNKRHQRALEMAHKLEKSGIRGA
LPDIEYMLDSQPMVCRTHLAQYLLDRGEVKTFGNAFKQYLAQGGKAYVKDQWFDIEDVVA
MIIQAGGIPVLAHPTRYGMGSNKLKQIVEHFKSIGGKGIEVCYPNLHPGQKNLLADWCRK
FELYASQGSDFHSPDKPWALFGKFAPLPESVTPVWQSPDWS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttagagatctccattgccacacagtagcgtctgacggcgacttaaccgtttca
gagctattgaagcttgcctctgaaagaggcgtcgatgagctggcgatcaccgatcatgac
tcaatcgattgccttgctgagagtatgagcctggccgaagggttcgacataaacctggtc
cccggtgttgaaatttcagcaactgcaggtagaaaaaaagatactttacacatcgttgga
ctgcaggtggattatcagcatgccggtttaacctcgtttttgagagatattcagaataaa
agacatcagcgtgcattagagatggcgcataagttggaaaaaagcggaataagaggcgca
ctccccgatatagaatacatgctggacagccagcctatggtttgtcgaactcatttagcc
caatacctactggacaggggagaagttaaaacctttggcaatgcctttaagcagtatctg
gcgcagggcggtaaagcctatgttaaagatcagtggttcgatatagaggatgttgtcgcc
atgattattcaagccggaggtattcctgtcctggcgcatcctactcgttatggtatgggc
tctaataaattgaagcagatagtagagcattttaaaagtattggtggtaagggtattgag
gtttgttaccctaatcttcaccctggacaaaaaaacttattggctgactggtgccgtaag
tttgagctgtatgcctctcagggctctgactttcattctcccgataagccgtgggcttta
tttggaaaatttgcgccattacctgagagcgttacgcctgtctggcagtctccggattgg
tcttga

DBGET integrated database retrieval system