KEGG   Kangiella sediminilitoris: KS2013_1758Help
Entry
KS2013_1758       CDS       T04467                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00471  D-Glutamine and D-glutamate metabolism
ksd00550  Peptidoglycan biosynthesis
ksd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KS2013_1758
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KS2013_1758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
    KS2013_1758
Enzymes [BR:ksd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     KS2013_1758
Peptidoglycan biosynthesis and degradation proteins [BR:ksd01011]
 Precursor biosynthesis
  Amino acid ligase
   KS2013_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOE50467
UniProt: A0A1B3BCJ4
Position
complement(1919947..1921272)
Genome map
AA seq 441 aa AA seqDB search
MQTQAIDNKNRLILGLGQTGLSVARYLSAQNQPFKVMDTRTHPPGADELAKIDKDALVDW
NGQKMLGYDQLVVSPGIAVTNPDIARAKDFGVEIVGDIELFAQANTTPVIAITGSNGKST
VTELVGLLLEASGNKALVGGNIGMPALELLQHSEKDAVSVLELSSFQLETTYTLQPAVAT
ILNVSEDHLDRYADYKEYVEAKQRIFNHAKKIVVNAEDEVTQPGRTGADVTSFGFGSKSD
WQVDLKNGALVGHHKKLMSLNELTLQGAHNALNVAAAFALLDAVGIPIDEAVIQSAKHYA
GMPHRSQLVAVKNGVTFINDSKATNVGATVAAINSFAPKFNHKIVLIAGGDAKGSDLSSL
ADSINKHAKTLICFGKDGVEIASLAQDRSVIVENLSQAVEQAVASSKPGDCVLLSPACAS
WDMFKNYIERGEQFEQLVEAL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcaagcaatcgacaataagaaccgcttaattctcggtttgggacaaaccggg
ctttcggttgcgcgttatttatcagcacaaaaccaacctttcaaggtcatggatacccgt
acacatccaccaggagcagacgagctcgcaaaaattgataaagacgccttagtagactgg
aatggccagaaaatgcttggctatgaccagttagtggtcagccctggaattgctgtgacg
aatccagacattgcaagagcgaaggattttggggttgaaatcgtaggtgatatcgagtta
tttgcacaggctaatactacgccagtaattgcgatcacaggatcaaatggtaagagcacg
gttactgaactggtaggtttgttgcttgaagccagcggcaacaaggcgttggttggcggc
aatataggtatgccggcgcttgaactgttgcagcatagtgaaaaagatgcagtctcagta
ttggaactttcaagcttccaacttgagacgacttatactttacaacctgcggttgccacc
attctgaatgtcagtgaagaccaccttgaccgatatgcagactacaaggaatacgtcgag
gctaaacaaagaatattcaatcatgccaagaagattgtagttaatgcggaagatgaagta
acacagccgggtagaactggagcagacgtcacttcctttggatttggcagcaaatcagat
tggcaggttgatctgaagaatggggcattagttggacaccacaaaaagctaatgtcctta
aatgagctaaccctgcagggtgctcataatgctctgaatgtcgctgcagccttcgctcta
cttgatgctgtaggcatccccattgatgaggcagtgattcagagtgcaaaacactatgct
ggtatgcctcaccgtagccagcttgtggcggtgaaaaatggggttacctttattaatgac
tctaaggcaaccaacgttggtgctacagttgccgctataaacagttttgccccgaaattt
aatcacaaaattgtattaatcgctggtggagatgcaaaaggttcggatttgtcgagtctt
gcggacagcattaataaacacgctaaaacattgatctgttttggcaaggatggtgttgag
attgcatcattagcacaagaccgctcagtcatcgtggaaaacttgtctcaggcagtggaa
caggctgtagcttccagcaagcccggtgattgcgtattactatcaccggcctgcgccagt
tgggatatgtttaagaactacatcgaacgtggtgagcagttcgagcaattggtggaggcg
ttatga

DBGET integrated database retrieval system