KEGG   Kangiella sediminilitoris: KS2013_2169Help
Entry
KS2013_2169       CDS       T04467                                 

Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ksd  Kangiella sediminilitoris
Pathway
ksd00270  Cysteine and methionine metabolism
ksd00480  Glutathione metabolism
ksd01100  Metabolic pathways
Module
ksd_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ksd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KS2013_2169
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KS2013_2169
Enzymes [BR:ksd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     KS2013_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AOE50874
UniProt: A0A1B3BDG4
Position
2332023..2332979
Genome map
AA seq 318 aa AA seqDB search
MSHSVLIVMDPIESIKTQKDTTFGLMLEAQRRGWTLHYCQPQDLYLEKDQVFAANQRVSV
EDNPQNWFQYQDAEQVLTECGDFSAILMRKDPPFDMNYIYSTYLLELAQQQGALVVNDPA
SLRDCNEKLFTAWFPEHTPSTLVSANAARLKAFAAEHQDIILKPLDGMGGASIFRAKKGD
PNLSVIIETLTSHGKNLAMAQQFIPEITDGDKRVLVVNGEVIPYTLARIPREGETRGNLA
AGGSGVPMPITDNEKRIAEAIAPELMRRGLLFVGLDIIGSFVTEINVTSPTCMRELENEY
QINIAGQLFSALEDQLKQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattccgtgttaattgttatggacccaatcgagtccattaagacccagaaagat
acgactttcggtttaatgctagaagcacaacgtcgcggctggactcttcattattgtcaa
ccgcaggatctttaccttgaaaaagaccaggtcttcgcggccaaccaaagagtcagcgtt
gaggataaccctcaaaactggttccaatatcaagatgctgagcaggttttaacagagtgc
ggtgatttctcagccattttgatgagaaaagatccgccgttcgatatgaactatatctac
agcacttatctcctggaactggcgcaacagcagggagccctggtagttaacgatccggcc
agtttacgtgactgtaacgaaaagctgtttactgcgtggttccctgagcacacaccgagc
accttggttagtgccaacgcggctcggcttaaagcatttgcagcagaacaccaggatatt
atcttaaaacctcttgatggcatgggtggcgcttcaattttccgtgcaaaaaagggtgac
cctaacctatcagtgatcatagaaaccctgacgtctcatggtaaaaacctggccatggca
cagcagttcattcctgaaattactgatggtgacaagcgggtgctggtggttaacggcgaa
gtgattccttacacacttgctcgcatcccaagggagggcgaaactcgtggtaacctcgct
gctggtggtagcggtgttccgatgcccattacagataacgaaaaacgaatagcagaagca
atagccccagaactgatgaggcgaggacttttgtttgttggactggatatcattggcagc
tttgtgacagaaataaacgtcaccagcccaacctgtatgcgagaattggagaacgagtat
cagattaatattgctggccaactatttagcgcattagaagatcagcttaaacagtaa

DBGET integrated database retrieval system