KEGG   Kytococcus sedentarius: Ksed_03400Help
Entry
Ksed_03400        CDS       T00974                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kse  Kytococcus sedentarius
Pathway
kse00900  Terpenoid backbone biosynthesis
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01130  Biosynthesis of antibiotics
Module
kse_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ksed_03400
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ksed_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACV05417
UniProt: C7NK30
Position
325803..326780
Genome map
AA seq 325 aa AA seqDB search
MTAQPAPRIATVRVPAKVNLALRVGAPDPGSGYHPLATVFHAVDLTDEVTVRRARRFSLE
VTGRFTEGVPADETNLAWQAVVLLRHHYRQTCGVRTPLPVAITLEKNIPVAGGMAGGSAD
AAGALLAANEVWGNELTIEDLRDIAAELGADVPFALLGGNALGLGRGDELSTVLARGQLH
WVFCVSPEGLSTPEVYRAFDRLAGWDQGPTMDTIEAWETPPEPPEDLLQALRSGDAVEVG
QHLENDLQEAAVELQPGLRETLAAGADVGALTGIVSGSGPTIALLASSHDHALDISVGMA
ALRPEVEVFVASGPAPGARVVSTRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagccggccccccgcatcgccaccgtccgcgttcccgcgaaggtgaacctc
gcgctgcgggtgggcgccccggacccggggagcggctaccacccgctggccaccgtcttc
cacgccgtcgacctgaccgatgaggtgaccgtccggcgcgcgcgccgcttctccctggag
gtgaccggccggttcaccgagggggtgccggccgacgagacgaacctcgcctggcaggcc
gtggtgctcctgcgccaccactaccgccagacctgtggggtgcggaccccgctgccggtg
gcgatcaccctcgagaagaacatcccggtggccgggggcatggccgggggttccgcggac
gccgcgggggccctcttggctgcgaacgaggtgtggggcaacgagctgaccatcgaggac
ctgcgcgacatcgctgccgagctgggcgccgacgtccccttcgccctgctgggcggcaac
gccctgggcctggggcgcggcgacgagctgtccacggtgctcgcgcggggccagctccac
tgggtgttctgcgtgagccccgagggcctgagcacgccggaggtctaccgcgcgttcgac
cgcctcgccgggtgggaccagggaccgacgatggacacgatcgaggcgtgggagaccccg
cccgagccgccggaggacctgctccaggccctgcgctccggggacgccgtcgaggtgggg
cagcacctggagaacgacctgcaggaggccgccgtcgagctgcagcccggcctgcgcgag
accctggcggccggtgccgatgtgggggccctgaccggcatcgtctcgggctccgggccc
accatcgcgctgttggcctccagccacgaccacgcgctggacatctcggtgggcatggcc
gccctgcgcccggaggtcgaggtcttcgtcgcctcgggtccggcgcccggcgcgcgcgtg
gtctccacccgctcctga

DBGET integrated database retrieval system