KEGG   Kytococcus sedentarius: Ksed_04520Help
Entry
Ksed_04520        CDS       T00974                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00020  Citrate cycle (TCA cycle)
kse00620  Pyruvate metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
Module
kse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_04520
   00020 Citrate cycle (TCA cycle)
    Ksed_04520
   00620 Pyruvate metabolism
    Ksed_04520
Enzymes [BR:kse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ksed_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ACV05525
UniProt: C7NKN9
Position
complement(445985..447604)
Genome map
AA seq 539 aa AA seqDB search
MSENQQVFMLPDLGEGLTEAEVVEWLVAEGDEVVIDQNVVTVETAKATVEVPIPFAGTVS
VLHGQVGDVMEVGRPLISVGGASGGAAGSGAASGADGGASGTQGADADPGHSASDPRAEH
EQYRREERAGAEVPQGDGETTDEGSGAVLIGFGTGHGGGSRRRRTPRGAARSTGAPAGTP
QGTSDSAPSRSPEATSPQAGASATTAHGTGQPTIAPRVISPLVRRLAAERGVDLASLTPS
QSDGVIRRADVEAASPSTPGAGESSQQGADSPETGTSRAHTATGAGTGAGTGAGASGTSV
AEQPQLTDERIPLTGLMRMMSERLTTSRSEIPDATTWVDVDATELLRTKDALKAARPDAG
IGVLPLMARIVVAGLTRFPALNAGIEMQDGTAVAIQRHARVNLGFAAQSPRGLVVPVVHD
AQDLSTAELALALRELTALARDGRLTPAQLTGGTFTLNNYGVFGVDGSTPIINHPEAAML
GVGRIIDRPWAVDGKVKVRKVTQLGLTFDHRVCDGGTAGGLLRFVADCVENPAVLLSEL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaccagcaggtgttcatgctgccggacctcggcgaggggctcaccgaggcc
gaggtggtcgagtggctcgtcgccgagggggacgaggtggtgatcgaccagaacgtggtc
accgtcgagaccgccaaggccaccgtggaggtgccgatcccgttcgcgggcaccgtctcg
gtgctgcacggccaggtgggtgacgtgatggaggtcggccgcccgctgatctcggtcggc
ggggcgtccggtggggcagcaggctccggcgcggcctctggggcggatggcggggcctcc
ggcacccagggcgcggacgccgacccgggccactccgcatcggacccccgcgcggagcac
gagcagtaccgccgcgaggagcgtgccggcgccgaggtgccgcagggtgacggcgagacc
accgacgagggctccggcgccgtgctcatcggcttcggcaccggacacgggggcggctcc
cgccgccgtcggaccccccgcggggcggcccggagcaccggtgcgcccgcgggaacgccg
cagggcacgtccgacagcgcaccctcgcgctcccccgaggccacgtccccgcaggccggg
gcgagtgcgacgacggcccacggcacggggcagcccaccatcgccccccgggtcatctcc
ccgctggtgcgccggctggccgccgagcgcggcgtcgacctggcgtcgctcactccctcg
cagtccgatggggtgatccgtcgcgccgacgtcgaggcggcctcgccttcgaccccggga
gccggcgagtcgtcgcagcagggtgcggactcccccgagacgggcacgtcccgggcccac
accgccacgggcgcgggcacgggcgcgggcaccggcgcaggcgcatctggcacatccgtg
gccgagcagccgcagctcaccgacgagcgcatcccgctcaccggcctgatgcggatgatg
tccgagcgcctcaccacctcccgcagcgagatccccgacgccaccacctgggtggacgtc
gacgcaaccgagctgctgcgcaccaaggacgccctcaaggccgcccgccccgatgcgggg
atcggcgtgctcccgctcatggcgcgcatcgtcgtggccggtctgacccgcttcccggcc
ctcaacgccggcatcgagatgcaggacggcacggccgtggccatccagcgccacgcacgg
gtcaacctgggtttcgcggcgcagtccccgcgcggcctggtggtgccggtggtccacgac
gcgcaggacctctccaccgccgagctggcgctggccctgcgcgagctcaccgccctggcg
cgcgacgggcgcctcacccccgcccagctcaccggcggcacgttcacgctgaacaactac
ggcgtgttcggggtggacggctcgacgccgatcatcaaccaccccgaggccgcgatgctg
ggggtcggccgcatcatcgaccgcccctgggccgttgacgggaaggtgaaggtccgcaag
gtgacccagctgggcctgaccttcgaccaccgggtctgcgacggcgggaccgccggcggg
ctgctgcgtttcgtcgccgactgcgtggagaacccggcggtgctgctcagcgagctctga

DBGET integrated database retrieval system