KEGG   Kytococcus sedentarius: Ksed_07750Help
Entry
Ksed_07750        CDS       T00974                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase, class III
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00071  Fatty acid degradation
kse00350  Tyrosine metabolism
kse00625  Chloroalkane and chloroalkene degradation
kse00626  Naphthalene degradation
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_07750
  Lipid metabolism
   00071 Fatty acid degradation
    Ksed_07750
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ksed_07750
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ksed_07750
   00626 Naphthalene degradation
    Ksed_07750
Enzymes [BR:kse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ksed_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACV05831
UniProt: C7NF07
Position
782813..783964
Genome map
AA seq 383 aa AA seqDB search
MSTHPGPLHTTGAVLRTLQAEAPYAQSAPLEVRRLDLDPPGEREILVRIEAASVCHSDLS
VVQGRRPRPLPMLLGHESAGIVEAVGPGVSTVGRGDRVVMTFLPRCGACEACDTEGRLPC
TPGSAANERGDLLGGGRRLHADGESVAHHLGVSGFATHAVVDERSVVPVEADVPADVAAV
LGCAVLTGGGAVMNVVELRRSSTIVVVGLGGVGMAAVLVARALGHEVVGVDGIASKRELA
RELGAARAWSPQEATEQEVRGHLVVDATGNPRGFETAVALTAPGGTTVTVGLPPADAEST
LRPLALVAQARTITGSYLGSAVPRRDIPRFVDLWRQGRLPIERLISSHIGLEEINRAMDR
LEAGDELRQVILLTDAPGEAAPA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcacccgggccccctgcacaccaccggagcggtcctgcgcacgctgcaggcc
gaggccccctacgcgcagtcggcacccctggaggtgcggcgcctcgacctggacccgccc
ggcgagcgggagatcctggtgcgaatcgaggccgccagcgtgtgccactccgacctctcg
gtggtccaggggaggcgtccgcgcccgctgcccatgctgctggggcacgagtccgccggc
atcgtcgaggcggtcggtcccggggtgtcgaccgtcgggcggggcgaccgggtggtcatg
accttcctgccgcggtgcggcgcgtgcgaggcctgcgacaccgagggccggctgccctgc
acccccggatcggcggccaacgagcgtggtgatctgctgggcggtgggcgccggctgcac
gcggacggggagtcggtggcgcaccacctgggtgtctcgggcttcgccacccacgccgtc
gtcgacgagcgctcggtcgtgccggtggaggccgacgtgccggccgatgtggctgccgtg
ctgggctgcgcggtcctcaccggtgggggagcggtgatgaacgtggtggagcttcgtcgc
agcagcaccatcgtggtcgtcgggctgggtggggtgggcatggccgccgtcctggtcgcg
cgtgcgctgggccacgaggtggtgggtgtcgacggcatcgcgagcaagcgtgagctggct
cgcgagctcggtgcggcccgggcctggtcgcctcaggaggccaccgagcaggaggtccgc
ggccacctggtggtggacgccaccggcaacccccgcggcttcgagaccgccgtggccctg
accgcacccggtggcaccaccgtcaccgtcggcctgcccccggccgatgccgagagcacc
ctgcggccgctggccctggtcgcgcaggcccgcaccatcaccggcagctacctcggctcg
gcggtcccgcgtcgtgacatcccccggttcgtcgacctgtggcgccagggcaggctgccg
atcgagcgcctcatcagctcccacatcgggctcgaggagatcaaccgcgccatggaccgc
ctcgaggccggtgacgagctgcggcaggtgatcctcctgaccgacgccccgggcgaggct
gcacccgcctga

DBGET integrated database retrieval system